Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGF20, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP95
Molecular weight:
25.81 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Met1–Thr211
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGF20, N-His

Product name ARO-P13081-100
Uniprot ID Q9NP95
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Molecular weight 25.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr211
Aliases /Synonyms FGF-20, FGF20, Fibroblast growth factor 20
Reference ARO-P13081
Note For research use only.
Molecular Constructor
Met1–Thr211
Product name ARO-P13081-1MG
Uniprot ID Q9NP95
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Molecular weight 25.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr211
Aliases /Synonyms FGF-20, FGF20, Fibroblast growth factor 20
Reference ARO-P13081
Note For research use only.
Molecular Constructor
Met1–Thr211
Product name ARO-P13081-50
Uniprot ID Q9NP95
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Molecular weight 25.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr211
Aliases /Synonyms FGF-20, FGF20, Fibroblast growth factor 20
Reference ARO-P13081
Note For research use only.
Molecular Constructor
Met1–Thr211

Introduction

Recombinant human FGF20 (rhFGF20) is a protein that is produced through genetic engineering techniques. It is a member of the fibroblast growth factor (FGF) family, which plays a crucial role in cell proliferation, differentiation, and survival. rhFGF20 has gained significant attention in the scientific community due to its potential therapeutic applications in various diseases. In this article, we will discuss the structure, activity, and applications of rhFGF20.

Structure of Recombinant Human FGF20

rhFGF20 is a small protein consisting of 211 amino acids with a molecular weight of approximately 23 kDa. It shares a high degree of sequence homology with other members of the FGF family, particularly FGF9 and FGF17. The protein has a conserved N-terminal signal peptide, which is responsible for its secretion. The mature form of rhFGF20 contains a highly conserved core region, which is essential for its biological activity. This core region is composed of 12 beta-strands and 12 alpha-helices, forming a compact three-dimensional structure.

Activity of Recombinant Human FGF20

The main function of rhFGF20 is to act as a growth factor and regulate cell proliferation, differentiation, and survival. It exerts its activity by binding to and activating specific cell surface receptors, known as FGF receptors (FGFRs). rhFGF20 has a high binding affinity for FGFR1c, FGFR2c, FGFR3c, and FGFR4, which are expressed in various tissues and cell types. Upon binding, rhFGF20 induces dimerization and autophosphorylation of the FGFRs, leading to the activation of downstream signaling pathways, such as the MAPK and PI3K/Akt pathways.

In addition to its role in cell growth and survival, rhFGF20 has also been shown to have neurotrophic and neuroprotective effects. It has been demonstrated to promote the survival and differentiation of dopaminergic neurons, making it a potential therapeutic candidate for Parkinson’s disease. Furthermore, rhFGF20 has been found to promote the regeneration of injured peripheral nerves, suggesting its potential in the treatment of nerve injuries.

Applications of Recombinant Human FGF20

Due to its diverse biological activities, rhFGF20 has shown promising potential in various therapeutic applications. One of the most studied applications of rhFGF20 is in the treatment of neurodegenerative diseases, particularly Parkinson’s disease. Preclinical studies have shown that rhFGF20 can protect and promote the survival of dopaminergic neurons, which are affected in Parkinson’s disease. Clinical trials are currently underway to evaluate the safety and efficacy of rhFGF20 in Parkinson’s patients.

Another potential application of rhFGF20 is in the treatment of nerve injuries. Studies have shown that rhFGF20 can promote the regeneration of damaged peripheral nerves, leading to improved functional recovery. This makes it a promising candidate for the treatment of nerve injuries caused by trauma or diseases.

In addition to its role in neurodegenerative diseases and nerve injuries, rhFGF20 has also shown potential in other conditions, such as wound healing and bone regeneration. It has been found to promote the proliferation and migration of skin cells, leading to faster wound healing. Moreover, rhFGF20 has been shown to enhance bone formation and repair, making it a potential therapeutic option for bone disorders.

Conclusion

In summary, recombinant human FGF20 is a small protein with diverse biological activities. It plays a crucial role in cell proliferation, differentiation, and survival by binding to and activating specific cell surface receptors. Due to its potential therapeutic applications, rhFGF20 has gained significant attention in the scientific community. Further research and clinical trials are needed to fully understand the potential of rhFGF20 in various diseases and disorders.

Recombinant Human FGF20, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGF20, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products