Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRPM7/LTRPC7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96QT4
Molecular weight:
39.70 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Gly93–Gly431
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRPM7/LTRPC7 Protein, N-His

Product name ARO-P11512-100
Uniprot ID Q96QT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYG
Molecular weight 39.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly93-Gly431
Aliases /Synonyms LTrpC7, LTRPC7, LTrpC-7, TRPM7, Transient receptor potential cation channel subfamily M member 7, CHAK1, Long transient receptor potential channel 7, Channel-kinase 1
Reference ARO-P11512
Note For research use only.
Molecular Constructor
Gly93–Gly431
Product name ARO-P11512-1MG
Uniprot ID Q96QT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYG
Molecular weight 39.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly93-Gly431
Aliases /Synonyms LTrpC7, LTRPC7, LTrpC-7, TRPM7, Transient receptor potential cation channel subfamily M member 7, CHAK1, Long transient receptor potential channel 7, Channel-kinase 1
Reference ARO-P11512
Note For research use only.
Molecular Constructor
Gly93–Gly431
Product name ARO-P11512-50
Uniprot ID Q96QT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYG
Molecular weight 39.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly93-Gly431
Aliases /Synonyms LTrpC7, LTRPC7, LTrpC-7, TRPM7, Transient receptor potential cation channel subfamily M member 7, CHAK1, Long transient receptor potential channel 7, Channel-kinase 1
Reference ARO-P11512
Note For research use only.
Molecular Constructor
Gly93–Gly431

Introduction

Recombinant Human TRPM7/LTRPC7 Protein, also known as Transient Receptor Potential Melastatin 7/Long Transient Receptor Potential Channel 7, is a protein that plays a crucial role in cellular and physiological processes. This protein is encoded by the TRPM7 gene and is a member of the transient receptor potential (TRP) family of ion channels. In this article, we will discuss the structure, activity, and application of Recombinant Human TRPM7/LTRPC7 Protein.

Structure of Recombinant Human TRPM7/LTRPC7 Protein

Recombinant Human TRPM7/LTRPC7 Protein is a large protein consisting of 1866 amino acids with a molecular weight of approximately 206 kDa. It is composed of six transmembrane domains, a cytoplasmic N-terminus, and a cytoplasmic C-terminus. The N-terminus contains a kinase domain, which is responsible for the protein’s autophosphorylation activity. The C-terminus contains a coiled-coil domain, which is involved in protein-protein interactions.

Activity of Recombinant Human TRPM7/LTRPC7 Protein

Recombinant Human TRPM7/LTRPC7 Protein is a non-selective cation channel that allows the passage of various ions, including magnesium, calcium, and zinc, across the cell membrane. It is also a bifunctional protein with both ion channel and kinase activities. The ion channel activity is regulated by changes in the concentration of intracellular magnesium and plays a crucial role in maintaining cellular magnesium homeostasis. The kinase activity of TRPM7 is involved in the regulation of cellular processes such as cell proliferation, cell survival, and cell migration.

Application of Recombinant Human TRPM7/LTRPC7 Protein

Recombinant Human TRPM7/LTRPC7 Protein has various applications in both research and therapeutic fields. Some of the major applications are listed below:

1. Research

Recombinant Human TRPM7/LTRPC7 Protein is widely used in research to study its structure, function, and role in various physiological processes. It is also used to investigate the role of TRPM7 in diseases such as cancer, neurodegenerative disorders, and cardiovascular diseases. Recombinant TRPM7 protein is also used to screen and identify potential inhibitors or activators of the channel and kinase activities.

2. Drug development

The ion channel and kinase activities of Recombinant Human TRPM7/LTRPC7 Protein make it a potential target for drug development. Inhibitors of TRPM7 have been shown to have anti-cancer properties, making it a promising target for cancer treatment. Additionally, TRPM7 inhibitors have also been investigated for their potential in treating neurodegenerative disorders and cardiovascular diseases.

3. Diagnostic tool

Recombinant Human TRPM7/LTRPC7 Protein can also be used as a diagnostic tool to detect the presence of autoantibodies against TRPM7 in patients with certain autoimmune diseases. These autoantibodies have been shown to be associated with the development of autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis.

4. Vaccine development

Recombinant Human TRPM7/LTRPC7 Protein has also been studied as a potential antigen for vaccine development. Studies have shown that TRPM7 is expressed in various types of cancer cells and is involved in cancer cell survival and proliferation. Therefore, targeting TRPM7 with a vaccine may induce an immune response against cancer cells, making it a potential therapeutic strategy in cancer treatment.

5. Cell-based therapies

The kinase activity of TRPM7 has been shown to play a crucial role in cell survival and migration. This makes Recombinant Human TRPM7/LTRPC7 Protein a potential candidate for cell-based therapies.

Recombinant Human TRPM7/LTRPC7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRPM7/LTRPC7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products