Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KLRG1/CLEC15A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96E93
Molecular weight:
15.34 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Ser74–Lys186
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KLRG1/CLEC15A Protein, N-His

Product name ARO-P10842-100
Uniprot ID Q96E93
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKK
Molecular weight 15.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser74-Lys186
Aliases /Synonyms Killer cell lectin-like receptor subfamily G member 1, C-type lectin domain family 15 member A, ITIM-containing receptor MAFA-L, MAFA-like receptor, Mast cell function-associated antigen, KLRG1, CLEC15A, MAFA, MAFAL
Reference ARO-P10842
Note For research use only.
Molecular Constructor
Ser74–Lys186
Product name ARO-P10842-1MG
Uniprot ID Q96E93
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKK
Molecular weight 15.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser74-Lys186
Aliases /Synonyms Killer cell lectin-like receptor subfamily G member 1, C-type lectin domain family 15 member A, ITIM-containing receptor MAFA-L, MAFA-like receptor, Mast cell function-associated antigen, KLRG1, CLEC15A, MAFA, MAFAL
Reference ARO-P10842
Note For research use only.
Molecular Constructor
Ser74–Lys186
Product name ARO-P10842-50
Uniprot ID Q96E93
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKK
Molecular weight 15.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser74-Lys186
Aliases /Synonyms Killer cell lectin-like receptor subfamily G member 1, C-type lectin domain family 15 member A, ITIM-containing receptor MAFA-L, MAFA-like receptor, Mast cell function-associated antigen, KLRG1, CLEC15A, MAFA, MAFAL
Reference ARO-P10842
Note For research use only.
Molecular Constructor
Ser74–Lys186

Introduction to Recombinant Human KLRG1/CLEC15A Protein

Recombinant Human KLRG1/CLEC15A Protein is a type I transmembrane protein that belongs to the killer cell lectin-like receptor family. It is also known as CD215 and is encoded by the KLRG1 gene. This protein is expressed on the surface of natural killer (NK) cells, T cells, and subsets of B cells and monocytes.

Structure of Recombinant Human KLRG1/CLEC15A Protein

The recombinant form of KLRG1/CLEC15A protein is produced by cloning the KLRG1 gene into a suitable expression vector and expressing it in a host cell. The resulting protein has a molecular weight of approximately 30 kDa and contains 246 amino acids. It is composed of an extracellular domain, a transmembrane domain, and a cytoplasmic tail.

The extracellular domain of KLRG1/CLEC15A protein contains a carbohydrate recognition domain (CRD) that is responsible for binding to its ligand. The CRD is a conserved region that is present in all members of the killer cell lectin-like receptor family and is involved in recognizing specific carbohydrate structures on target cells.

The transmembrane domain of KLRG1/CLEC15A protein anchors it to the cell membrane, while the cytoplasmic tail contains signaling motifs that are important for its function. This protein also has a single N-linked glycosylation site that is essential for its proper folding and stability.

Activity of Recombinant Human KLRG1/CLEC15A Protein

KLRG1/CLEC15A protein is a type II transmembrane protein that acts as an inhibitory receptor on NK cells and T cells. It is involved in regulating the activation and function of these cells by interacting with its ligand, a carbohydrate structure called sialylated O-linked glycan.

Upon binding to its ligand, KLRG1/CLEC15A protein initiates a signaling cascade that leads to the inhibition of NK cell and T cell activation. This results in the suppression of cytokine production and cytotoxic activity of these cells, thus playing a crucial role in maintaining immune homeostasis.

In addition to its inhibitory function, KLRG1/CLEC15A protein has also been shown to have a co-stimulatory role in certain immune responses. It can enhance the proliferation and cytokine production of regulatory T cells, which are important for maintaining self-tolerance and preventing autoimmune diseases.

Application of Recombinant Human KLRG1/CLEC15A Protein

The recombinant form of KLRG1/CLEC15A protein is widely used in research and diagnostic applications. It is commonly used as a tool to study the role of this protein in immune regulation and its potential as a therapeutic target.

One of the major applications of recombinant KLRG1/CLEC15A protein is in the field of cancer immunotherapy. It has been shown to play a crucial role in the suppression of anti-tumor immune responses, making it a potential target for enhancing the efficacy of cancer immunotherapies.

Moreover, recombinant KLRG1/CLEC15A protein has also been used in studies investigating its role in autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. It has been shown to be upregulated in these diseases, suggesting that it may play a role in their pathogenesis.

In conclusion, Recombinant Human KLRG1/CLEC15A Protein is a key player in immune regulation and has diverse roles in various immune responses. Its structure, activity, and application make it a valuable tool for understanding immune function and its potential as a therapeutic target. Further research on this protein may lead to the development of novel treatments for immune-related disorders.

Recombinant Human KLRG1/CLEC15A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KLRG1/CLEC15A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products