Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRPC4AP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TEL6
Molecular weight:
11.93 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Leu427–Lys511
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRPC4AP Protein, N-His

Product name ARO-P12008-100
Uniprot ID Q8TEL6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Molecular weight 11.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu427-Lys511
Aliases /Synonyms Trp4-associated protein, Protein TRUSS, C20orf188, Protein TAP1, Short transient receptor potential channel 4-associated protein, TRRP4AP, TRPC4AP, Trpc4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein
Reference ARO-P12008
Note For research use only.
Molecular Constructor
Leu427–Lys511
Product name ARO-P12008-1MG
Uniprot ID Q8TEL6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Molecular weight 11.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu427-Lys511
Aliases /Synonyms Trp4-associated protein, Protein TRUSS, C20orf188, Protein TAP1, Short transient receptor potential channel 4-associated protein, TRRP4AP, TRPC4AP, Trpc4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein
Reference ARO-P12008
Note For research use only.
Molecular Constructor
Leu427–Lys511
Product name ARO-P12008-50
Uniprot ID Q8TEL6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Molecular weight 11.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu427-Lys511
Aliases /Synonyms Trp4-associated protein, Protein TRUSS, C20orf188, Protein TAP1, Short transient receptor potential channel 4-associated protein, TRRP4AP, TRPC4AP, Trpc4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein
Reference ARO-P12008
Note For research use only.
Molecular Constructor
Leu427–Lys511

Introduction

Recombinant Human TRPC4AP Protein is a highly specialized protein that plays a crucial role in various cellular processes. This protein is produced through recombinant DNA technology, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human TRPC4AP Protein

The Recombinant Human TRPC4AP Protein is a 55 kDa protein consisting of 507 amino acids. It belongs to the TRP (Transient Receptor Potential) superfamily of ion channels and is specifically classified as a TRP cation channel subfamily C member 4-associated protein (TRPC4AP). The protein is composed of several domains, including a coiled-coil domain, a TRP domain, and a C-terminal PDZ-binding motif. These domains are essential for the protein’s function and interaction with other molecules.

Activity of Recombinant Human TRPC4AP Protein

The main function of Recombinant Human TRPC4AP Protein is to regulate the activity of TRPC4 channels. These channels are non-selective cation channels that play a crucial role in calcium signaling and cell growth. TRPC4AP acts as a scaffold protein, binding to the C-terminus of TRPC4 channels and regulating their activity. This regulation is achieved through the coiled-coil domain, which interacts with other proteins to form a complex that modulates the opening and closing of TRPC4 channels.

In addition to its role in regulating TRPC4 channels, Recombinant Human TRPC4AP Protein also plays a role in cellular signaling pathways. It has been shown to interact with other proteins involved in cellular processes such as cell migration, apoptosis, and cell cycle regulation. This makes it a potential target for therapeutic interventions in diseases related to these processes.

Application of Recombinant Human TRPC4AP Protein

The use of Recombinant Human TRPC4AP Protein has been instrumental in advancing research in the field of calcium signaling and cellular processes. Its ability to regulate TRPC4 channels and interact with other proteins has made it a valuable tool for studying the role of these channels in various physiological and pathological conditions.

One of the main applications of Recombinant Human TRPC4AP Protein is in drug discovery and development. As TRPC4 channels have been implicated in various diseases, targeting these channels with specific inhibitors or activators could lead to the development of novel therapeutics. Recombinant Human TRPC4AP Protein can be used to screen potential compounds for their ability to modulate TRPC4 channel activity, providing valuable insights for drug development.

Another potential application of Recombinant Human TRPC4AP Protein is in cancer research. Studies have shown that TRPC4 channels play a role in the proliferation and migration of cancer cells. As TRPC4AP regulates the activity of these channels, it could be a potential target for cancer therapy. Recombinant Human TRPC4AP Protein can be used to study the interaction between TRPC4AP and TRPC4 channels in cancer cells, providing a better understanding of the underlying mechanisms and potential therapeutic interventions.

Conclusion

In summary, Recombinant Human TRPC4AP Protein is a versatile protein with a crucial role in regulating TRPC4 channels and cellular signaling pathways. Its structure, activity, and potential applications make it a valuable tool for research and therapeutic purposes. As our understanding of its function and interaction with other proteins continues to grow, Recombinant Human TRPC4AP Protein could hold even more potential for future advancements in the field of biology and medicine.

Recombinant Human TRPC4AP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRPC4AP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products