Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARMC8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IUR7
Molecular weight:
43.05 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Glu16–Lys378
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARMC8 Protein, N-His

Product name ARO-P11917-100
Uniprot ID Q8IUR7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKK
Molecular weight 43.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu16-Lys378
Aliases /Synonyms ARMC8, Armadillo repeat-containing protein 8
Reference ARO-P11917
Note For research use only.
Molecular Constructor
Glu16–Lys378
Product name ARO-P11917-1MG
Uniprot ID Q8IUR7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKK
Molecular weight 43.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu16-Lys378
Aliases /Synonyms ARMC8, Armadillo repeat-containing protein 8
Reference ARO-P11917
Note For research use only.
Molecular Constructor
Glu16–Lys378
Product name ARO-P11917-50
Uniprot ID Q8IUR7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKK
Molecular weight 43.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu16-Lys378
Aliases /Synonyms ARMC8, Armadillo repeat-containing protein 8
Reference ARO-P11917
Note For research use only.
Molecular Constructor
Glu16–Lys378

Introduction to Recombinant Human ARMC8 Protein

Recombinant Human ARMC8 Protein, also known as Armadillo repeat-containing protein 8, is a highly conserved protein that plays a crucial role in various cellular processes. This protein is encoded by the ARMC8 gene and is found in various organisms, including humans. Recombinant Human ARMC8 Protein is a valuable tool for researchers and has a wide range of applications in the fields of molecular biology, genetics, and biochemistry.

Structure of Recombinant Human ARMC8 Protein

Recombinant Human ARMC8 Protein is a 74 kDa protein that consists of 660 amino acids. It belongs to the armadillo repeat family of proteins, which are characterized by the presence of multiple armadillo repeats. These repeats are approximately 42 amino acids long and form a superhelical structure that is responsible for protein-protein interactions. Recombinant Human ARMC8 Protein contains 17 armadillo repeats, which are arranged in tandem and form a curved structure. This unique structure is crucial for the protein’s function and allows it to interact with various binding partners.

Activity of Recombinant Human ARMC8 Protein

Recombinant Human ARMC8 Protein is a multifunctional protein that is involved in various cellular processes, including cell cycle regulation, cell proliferation, and cell migration. It has been shown to interact with several proteins, such as β-catenin, APC, and GSK3β, which are key players in the Wnt signaling pathway. This interaction is essential for the regulation of β-catenin stability and its translocation to the nucleus, where it acts as a transcriptional regulator. Recombinant Human ARMC8 Protein has also been implicated in the regulation of microtubule dynamics and the maintenance of centrosome integrity.

In addition to its role in cellular processes, Recombinant Human ARMC8 Protein has also been linked to various diseases. Mutations in the ARMC8 gene have been associated with ciliary dyskinesia, a genetic disorder characterized by defective cilia function. This highlights the importance of Recombinant Human ARMC8 Protein in the proper functioning of cilia, which are essential for various physiological processes, including cell signaling and fluid movement.

Application of Recombinant Human ARMC8 Protein

Recombinant Human ARMC8 Protein has a wide range of applications in the fields of molecular biology, genetics, and biochemistry. Its ability to interact with various proteins makes it a valuable tool for studying protein-protein interactions and signaling pathways. It can also be used to investigate the role of ARMC8 in various cellular processes, such as cell cycle regulation and cilia function.

Furthermore, Recombinant Human ARMC8 Protein can be used in drug discovery and development. As it is involved in the Wnt signaling pathway, which plays a crucial role in cancer development and progression, targeting ARMC8 could have therapeutic potential in cancer treatment. Recombinant Human ARMC8 Protein can also be used to screen for potential inhibitors or activators of the Wnt signaling pathway.

In addition, Recombinant Human ARMC8 Protein can be used as an antigen in antibody production. Antibodies against ARMC8 can be used to study its expression and localization in various tissues and cell types. They can also be used in diagnostic assays to detect ARMC8 levels in patient samples.

Conclusion

Recombinant Human ARMC8 Protein is a highly conserved protein with a unique structure and a wide range of functions. Its involvement in various cellular processes and its association with diseases make it a valuable tool for researchers. With its diverse applications in molecular biology, genetics, and biochemistry, Recombinant Human ARMC8 Protein continues to be an important protein in the scientific community.

Recombinant Human ARMC8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARMC8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products