Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SMS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52788
Molecular weight:
43.43 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Pro366
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SMS Protein, N-His

Product name ARO-P11909-100
Uniprot ID P52788
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Molecular weight 43.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro366
Aliases /Synonyms Spermine synthase, SPMSY, SMS, Spermidine aminopropyltransferase
Reference ARO-P11909
Note For research use only.
Molecular Constructor
Met1–Pro366
Product name ARO-P11909-1MG
Uniprot ID P52788
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Molecular weight 43.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro366
Aliases /Synonyms Spermine synthase, SPMSY, SMS, Spermidine aminopropyltransferase
Reference ARO-P11909
Note For research use only.
Molecular Constructor
Met1–Pro366
Product name ARO-P11909-50
Uniprot ID P52788
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Molecular weight 43.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro366
Aliases /Synonyms Spermine synthase, SPMSY, SMS, Spermidine aminopropyltransferase
Reference ARO-P11909
Note For research use only.
Molecular Constructor
Met1–Pro366

Introduction

Recombinant Human SMS Protein, also known as spermine synthase, is a key enzyme involved in the biosynthesis of polyamines. Polyamines are essential for cell growth, proliferation, and differentiation, making SMS protein a crucial component in many biological processes. In this article, we will discuss the structure, activity, and applications of recombinant human SMS protein.

Structure of Recombinant Human SMS Protein

Recombinant Human SMS Protein is a 34 kDa protein consisting of 311 amino acids. It is encoded by the SMS gene located on chromosome X in humans. The protein has a highly conserved structure, with 98% similarity in amino acid sequence between human and mouse SMS protein.

Structurally, recombinant human SMS protein consists of two domains: an N-terminal domain and a C-terminal domain. The N-terminal domain contains the active site, which is responsible for the catalytic activity of the enzyme. The C-terminal domain is involved in substrate binding and regulation of enzyme activity.

Activity of Recombinant Human SMS Protein

The primary function of recombinant human SMS protein is to catalyze the conversion of spermidine to spermine, a process known as spermine biosynthesis. This reaction involves the transfer of an aminopropyl group from decarboxylated S-adenosylmethionine to spermidine, forming spermine and 5′-methylthioadenosine (MTA) as a byproduct.

Recombinant human SMS protein is highly specific for spermidine as its substrate and has a relatively low Km value, indicating high affinity for the substrate. The enzyme is also regulated by the concentration of its substrate, with increasing spermidine levels leading to the inhibition of enzyme activity.

In addition to its role in spermine biosynthesis, recombinant human SMS protein has been found to have other functions, such as regulating cell growth and apoptosis. It has been shown that SMS protein can interact with other proteins involved in cell death pathways, suggesting a potential role in modulating cell survival.

Applications of Recombinant Human SMS Protein

Recombinant human SMS protein has a wide range of applications in both research and industrial settings.

Antigen for Antibody Production

Recombinant human SMS protein can be used as an antigen for the production of specific antibodies. These antibodies can then be used for various applications, such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).

Drug Target for Cancer Therapy

Due to its involvement in cell growth and proliferation, recombinant human SMS protein has been identified as a potential drug target for cancer therapy. Inhibition of SMS protein activity can lead to a decrease in polyamine levels, which are essential for cancer cell growth. Several studies have shown promising results in targeting SMS protein for the treatment of various types of cancer.

Biomarker for Disease Diagnosis

Abnormal levels of polyamines have been linked to various diseases, such as cancer, diabetes, and neurological disorders. Recombinant human SMS protein can serve as a biomarker for these diseases, as changes in its activity can reflect changes in polyamine levels. This can aid in the early diagnosis and monitoring of disease progression.

Conclusion

Recombinant Human SMS Protein is a crucial enzyme involved in spermine biosynthesis and other biological processes. Its highly conserved structure and specific activity make it a valuable tool for various applications, such as antibody production, cancer therapy, and disease diagnosis. Further research on the structure and function of SMS protein can lead to a better understanding of its role in health and disease.

Recombinant Human SMS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SMS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products