Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ASIC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78348
Molecular weight:
43.10 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
His72–Tyr426
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ASIC1 Protein, N-His

Product name ARO-P11906-100
Uniprot ID P78348
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAY
Molecular weight 43.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His72-Tyr426
Aliases /Synonyms ASIC1, Amiloride-sensitive cation channel 2, neuronal, BNaC2, Brain sodium channel 2, ACCN2, Acid-sensing ion channel 1, BNAC2
Reference ARO-P11906
Note For research use only.
Molecular Constructor
His72–Tyr426
Product name ARO-P11906-1MG
Uniprot ID P78348
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAY
Molecular weight 43.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His72-Tyr426
Aliases /Synonyms ASIC1, Amiloride-sensitive cation channel 2, neuronal, BNaC2, Brain sodium channel 2, ACCN2, Acid-sensing ion channel 1, BNAC2
Reference ARO-P11906
Note For research use only.
Molecular Constructor
His72–Tyr426
Product name ARO-P11906-50
Uniprot ID P78348
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAY
Molecular weight 43.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His72-Tyr426
Aliases /Synonyms ASIC1, Amiloride-sensitive cation channel 2, neuronal, BNaC2, Brain sodium channel 2, ACCN2, Acid-sensing ion channel 1, BNAC2
Reference ARO-P11906
Note For research use only.
Molecular Constructor
His72–Tyr426

Title: Introduction to Recombinant Human ASIC1 Protein

Recombinant Human ASIC1 Protein, also known as Acid Sensing Ion Channel 1, is a protein that plays a crucial role in the nervous system. It is a member of the ASIC family of proteins, which are involved in sensing and responding to changes in extracellular pH levels. The recombinant form of this protein is produced by genetic engineering techniques, making it a valuable tool for researchers in various fields of biology and medicine.

Title: Structure of Recombinant Human ASIC1 Protein

Recombinant Human ASIC1 Protein is composed of 528 amino acids and has a molecular weight of approximately 57 kDa. It is a transmembrane protein, with two transmembrane domains and a large extracellular loop. The extracellular loop contains the binding site for protons, which allows the protein to sense changes in pH levels. The intracellular domain of the protein is responsible for its signaling activity.

Title: Activity of Recombinant Human ASIC1 Protein

Recombinant Human ASIC1 Protein is primarily known for its role in sensing and responding to changes in pH levels. When the extracellular pH decreases, the protein undergoes a conformational change, which leads to the opening of its ion channel. This allows for the influx of cations, such as sodium and calcium, into the cell. This influx of ions triggers a signaling cascade, leading to various physiological responses.

Apart from its role in pH sensing, Recombinant Human ASIC1 Protein has also been shown to be involved in pain sensation, learning and memory, and neurodegenerative diseases. It has been found to be highly expressed in the brain, particularly in areas involved in learning and memory, such as the hippocampus and amygdala. Studies have also shown that mutations in the gene encoding for this protein can lead to neurological disorders, highlighting its importance in the nervous system.

Title: Applications of Recombinant Human ASIC1 Protein

The recombinant form of ASIC1 protein has various applications in the field of research. Its ability to sense and respond to changes in pH levels makes it a valuable tool in studying the role of pH in various physiological processes. It has been used to investigate the mechanisms of pain sensation, as well as the role of pH in learning and memory.

Recombinant Human ASIC1 Protein has also been used in drug discovery and development. Its involvement in pain sensation makes it a potential target for analgesic drugs. By studying the structure and activity of this protein, researchers can develop drugs that can modulate its function and potentially treat conditions such as chronic pain.

Furthermore, the recombinant form of ASIC1 protein has been used in diagnostic assays. Its ability to bind to protons makes it a useful tool in detecting changes in pH levels, which can be indicative of certain diseases or conditions. This has potential applications in the diagnosis and monitoring of diseases such as cancer and neurological disorders.

In conclusion, Recombinant Human ASIC1 Protein is a crucial protein in the nervous system, involved in pH sensing and various physiological processes. Its recombinant form has numerous applications in research, drug development, and diagnostics. With ongoing studies and advancements in genetic engineering techniques, this protein continues to be a valuable tool in understanding the complex mechanisms of the nervous system.

Recombinant Human ASIC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ASIC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products