Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZY9
Molecular weight:
23.71 kDa

Original price was: €388.00.Current price is: €329.00.

100ug 15% OFF + 329 loyalty points
Ala2–Lys91
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep

Product name ARO-P12338-100
Uniprot ID Q9BZY9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRK
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys91
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM31, TRIM31, Tripartite motif-containing protein 31, C6orf13, RNF, RING-type E3 ubiquitin transferase TRIM31
Reference ARO-P12338
Note For research use only.
Molecular Constructor
Ala2–Lys91
Product name ARO-P12338-1MG
Uniprot ID Q9BZY9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRK
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys91
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM31, TRIM31, Tripartite motif-containing protein 31, C6orf13, RNF, RING-type E3 ubiquitin transferase TRIM31
Reference ARO-P12338
Note For research use only.
Molecular Constructor
Ala2–Lys91
Product name ARO-P12338-50
Uniprot ID Q9BZY9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRK
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys91
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM31, TRIM31, Tripartite motif-containing protein 31, C6orf13, RNF, RING-type E3 ubiquitin transferase TRIM31
Reference ARO-P12338
Note For research use only.
Molecular Constructor
Ala2–Lys91

Introduction

Recombinant Human TRIM31 Protein is a highly versatile and important protein that plays a crucial role in various biological processes. It belongs to the tripartite motif (TRIM) family of proteins, which are characterized by the presence of a RING domain, a B-box domain, and a coiled-coil domain. TRIM proteins have been shown to be involved in a wide range of cellular functions, including innate immunity, cell differentiation, and development.

Structure of Recombinant Human TRIM31 Protein

The recombinant human TRIM31 protein is a 62 kDa protein that is composed of 557 amino acids. It contains a RING domain at the N-terminus, followed by a B-box domain and a coiled-coil domain. The RING domain is responsible for the E3 ubiquitin ligase activity of TRIM31, while the B-box and coiled-coil domains are involved in protein-protein interactions.

Activity of Recombinant Human TRIM31 Protein

The primary function of TRIM31 is to act as an E3 ubiquitin ligase, which is responsible for targeting specific proteins for degradation by the proteasome. This activity is essential for maintaining cellular homeostasis and regulating various signaling pathways. TRIM31 has been shown to regulate the activity of several important proteins, including NF-kB, p53, and c-Myc.

In addition to its E3 ubiquitin ligase activity, TRIM31 also has other important functions. It has been shown to play a role in regulating cell proliferation, differentiation, and apoptosis. It also plays a crucial role in the innate immune response by regulating the activity of various immune signaling pathways.

Application of Recombinant Human TRIM31 Protein

Recombinant Human TRIM31 Protein has a wide range of applications in both research and medical fields. Its ability to regulate various cellular processes makes it a valuable tool for studying the mechanisms of diseases and developing potential treatments. Some of the key applications of recombinant TRIM31 protein are:

1. Cancer research

TRIM31 has been shown to be overexpressed in various types of cancer, including breast, lung, and liver cancer. Its E3 ubiquitin ligase activity has been linked to the degradation of tumor suppressor proteins, leading to uncontrolled cell growth and cancer progression. Recombinant TRIM31 protein can be used to study the role of TRIM31 in different types of cancer and develop potential therapies targeting this protein.

2. Innate immunity

TRIM31 plays a crucial role in regulating the activity of various immune signaling pathways, making it an important protein in the innate immune response. Recombinant TRIM31 protein can be used to study the mechanisms of innate immunity and develop potential therapies for immune-related disorders.

3. Protein degradation studies

As an E3 ubiquitin ligase, TRIM31 is involved in targeting specific proteins for degradation. Recombinant TRIM31 protein can be used to study the process of protein degradation and its role in various cellular processes.

4. Protein-protein interaction studies

The B-box and coiled-coil domains of TRIM31 are involved in protein-protein interactions, making it an important protein for studying protein-protein interactions. Recombinant TRIM31 protein can be used to identify and study the interactions between TRIM31 and other proteins, providing insights into its role in various cellular functions.

5. Therapeutic development

Given its important role in various cellular processes, TRIM31 has been identified as a potential therapeutic target for various diseases. Recombinant TRIM31 protein can be used to screen and develop potential inhibitors or activators of this protein for therapeutic purposes.

Conclusion

In summary, Recombinant Human TRIM31 Protein is a versatile and important protein with a wide range of functions in various biological processes. Its structure, activity, and applications

Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products