Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14444
Molecular weight:
27.85 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Arg132–Asn251
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep

Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep

Product name ARO-P12592-100
Uniprot ID Q14444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN
Molecular weight 27.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg132-Asn251
Aliases /Synonyms GPI-anchored protein p137, Cytoplasmic activation- and proliferation-associated protein 1, p137GPI, RNG105, M11S1, Caprin-1, Cell cycle-associated protein 1, RNA granule protein 105, CAPRIN1, GPIP137, GPI-anchored membrane protein 1, GPI-p137, GPIAP1, Membrane component chromosome 11 surface marker 1
Reference ARO-P12592
Note For research use only.
Molecular Constructor
Arg132–Asn251
Product name ARO-P12592-1MG
Uniprot ID Q14444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN
Molecular weight 27.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg132-Asn251
Aliases /Synonyms GPI-anchored protein p137, Cytoplasmic activation- and proliferation-associated protein 1, p137GPI, RNG105, M11S1, Caprin-1, Cell cycle-associated protein 1, RNA granule protein 105, CAPRIN1, GPIP137, GPI-anchored membrane protein 1, GPI-p137, GPIAP1, Membrane component chromosome 11 surface marker 1
Reference ARO-P12592
Note For research use only.
Molecular Constructor
Arg132–Asn251
Product name ARO-P12592-50
Uniprot ID Q14444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN
Molecular weight 27.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg132-Asn251
Aliases /Synonyms GPI-anchored protein p137, Cytoplasmic activation- and proliferation-associated protein 1, p137GPI, RNG105, M11S1, Caprin-1, Cell cycle-associated protein 1, RNA granule protein 105, CAPRIN1, GPIP137, GPI-anchored membrane protein 1, GPI-p137, GPIAP1, Membrane component chromosome 11 surface marker 1
Reference ARO-P12592
Note For research use only.
Molecular Constructor
Arg132–Asn251

Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products