Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZEB2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60315
Molecular weight:
35.15 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ser647–Ser705
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZEB2 Protein, N-GST & C-His

Product name ARO-P12594-100
Uniprot ID O60315
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
Molecular weight 35.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser647-Ser705
Aliases /Synonyms Smad-interacting protein 1, SIP1, SMADIP1, ZFX1B, KIAA0569, ZEB2, Zinc finger E-box-binding homeobox 2, ZFHX1B, Zinc finger homeobox protein 1b
Reference ARO-P12594
Note For research use only.
Molecular Constructor
Ser647–Ser705
Product name ARO-P12594-1MG
Uniprot ID O60315
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
Molecular weight 35.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser647-Ser705
Aliases /Synonyms Smad-interacting protein 1, SIP1, SMADIP1, ZFX1B, KIAA0569, ZEB2, Zinc finger E-box-binding homeobox 2, ZFHX1B, Zinc finger homeobox protein 1b
Reference ARO-P12594
Note For research use only.
Molecular Constructor
Ser647–Ser705
Product name ARO-P12594-50
Uniprot ID O60315
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
Molecular weight 35.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser647-Ser705
Aliases /Synonyms Smad-interacting protein 1, SIP1, SMADIP1, ZFX1B, KIAA0569, ZEB2, Zinc finger E-box-binding homeobox 2, ZFHX1B, Zinc finger homeobox protein 1b
Reference ARO-P12594
Note For research use only.
Molecular Constructor
Ser647–Ser705

Introduction

Recombinant Human ZEB2 Protein, also known as Zinc Finger E-Box Binding Homeobox 2, is a transcription factor that plays a crucial role in various biological processes, including embryonic development, cell differentiation, and tumor progression. This protein is encoded by the ZEB2 gene and is a member of the ZEB family of transcription factors.

Structure of Recombinant Human ZEB2 Protein

The recombinant form of ZEB2 protein is a 200 kDa protein consisting of 1212 amino acids. It contains several structural domains, including two zinc finger domains, a homeobox domain, and a C-terminal domain. The zinc finger domains are responsible for DNA binding, while the homeobox domain is involved in protein-protein interactions. The C-terminal domain is responsible for transcriptional activation and repression.

Activity of Recombinant Human ZEB2 Protein

Recombinant Human ZEB2 Protein is a transcription factor that regulates gene expression by binding to specific DNA sequences. It is primarily involved in the process of epithelial to mesenchymal transition (EMT), which is essential for embryonic development and wound healing. EMT is also implicated in tumor progression and metastasis, making ZEB2 an important target for cancer research.

ZEB2 can act as both a transcriptional activator and a repressor, depending on the target gene and cellular context. It regulates the expression of genes involved in cell adhesion, migration, and invasion, which are crucial for EMT and tumor progression. ZEB2 also plays a role in maintaining the balance between stem cell self-renewal and differentiation.

Applications of Recombinant Human ZEB2 Protein

Recombinant Human ZEB2 Protein has various applications in both research and clinical settings. Here are some of the key applications of this protein:

1. Cancer Research

As mentioned earlier, ZEB2 is a critical regulator of EMT, which is involved in cancer progression and metastasis. Therefore, recombinant ZEB2 protein is widely used in cancer research to study the mechanisms of EMT and identify potential therapeutic targets. It is also used to evaluate the efficacy of anti-cancer drugs that target ZEB2 or its downstream signaling pathways.

2. Developmental Biology

ZEB2 is essential for embryonic development, particularly in the formation of various tissues and organs. Recombinant Human ZEB2 Protein is used to study the role of this transcription factor in different developmental processes, such as neural crest formation and limb development. It is also used to generate animal models with altered ZEB2 expression, which helps in understanding the consequences of ZEB2 dysfunction.

3. Tissue Engineering

Recombinant Human ZEB2 Protein is also used in tissue engineering to promote the differentiation of stem cells into specific cell types. ZEB2 is known to play a role in the differentiation of mesenchymal stem cells into osteoblasts and chondrocytes. Therefore, recombinant ZEB2 protein is used to induce the differentiation of stem cells into these cell types, which can be used for regenerative medicine and tissue repair.

4. Diagnostic Applications

ZEB2 has been identified as a potential biomarker for various diseases, including cancer and developmental disorders. Recombinant Human ZEB2 Protein is used in diagnostic assays to detect the levels of this protein in patient samples. Abnormal levels of ZEB2 can indicate the presence of certain diseases or help in disease prognosis.

5. Therapeutic Applications

Given the critical role of ZEB2 in cancer progression, it is being explored as a potential therapeutic target. Recombinant Human ZEB2 Protein can be used to develop drugs that specifically target this transcription factor and inhibit its activity. This can potentially lead to the development of novel treatments for cancer and other diseases associated with ZEB2 dysfunction.

Conclusion

In summary

Recombinant Human ZEB2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ZEB2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products