Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human TPO Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P07202
Molecular weight:
22.90 kDa

Original price was: €405.00.Current price is: €329.00.

100ug 19% OFF + 329 loyalty points
Glu749–Arg843
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Human TPO Protein, N-His-SUMO
Recombinant Human TPO Protein, N-His-SUMO

Recombinant Human TPO Protein, N-His-SUMO

Product name ARO-P11559-100
Uniprot ID P07202
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVDSGR
Molecular weight 22.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu749-Arg843
Aliases /Synonyms Thyroid peroxidase, TPO
Reference ARO-P11559
Note For research use only.
Molecular Constructor
Glu749–Arg843
Product name ARO-P11559-1MG
Uniprot ID P07202
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVDSGR
Molecular weight 22.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu749-Arg843
Aliases /Synonyms Thyroid peroxidase, TPO
Reference ARO-P11559
Note For research use only.
Molecular Constructor
Glu749–Arg843
Product name ARO-P11559-50
Uniprot ID P07202
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVDSGR
Molecular weight 22.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu749-Arg843
Aliases /Synonyms Thyroid peroxidase, TPO
Reference ARO-P11559
Note For research use only.
Molecular Constructor
Glu749–Arg843

SDS-PAGE for Recombinant Human TPO Protein, N-His-SUMO

SDS-PAGE for Recombinant Human TPO Protein, N-His-SUMO

Recombinant Human TPO Protein, N-His-SUMO, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human TPO Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TPO Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products