Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPR107 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5VW38
Molecular weight:
25.88 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Arg40–Asn250
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPR107 Protein, N-His

Product name ARO-P10741-100
Uniprot ID Q5VW38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKN
Molecular weight 25.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg40-Asn250
Aliases /Synonyms LUSTR1, Lung seven transmembrane receptor 1, GPR107, KIAA1624, Protein GPR107
Reference ARO-P10741
Note For research use only.
Molecular Constructor
Arg40–Asn250
Product name ARO-P10741-1MG
Uniprot ID Q5VW38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKN
Molecular weight 25.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg40-Asn250
Aliases /Synonyms LUSTR1, Lung seven transmembrane receptor 1, GPR107, KIAA1624, Protein GPR107
Reference ARO-P10741
Note For research use only.
Molecular Constructor
Arg40–Asn250
Product name ARO-P10741-50
Uniprot ID Q5VW38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKN
Molecular weight 25.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg40-Asn250
Aliases /Synonyms LUSTR1, Lung seven transmembrane receptor 1, GPR107, KIAA1624, Protein GPR107
Reference ARO-P10741
Note For research use only.
Molecular Constructor
Arg40–Asn250

Recombinant Human GPR107 Protein is a type of protein that has been produced through genetic engineering techniques. This protein is a member of the G protein-coupled receptor (GPCR) family and is encoded by the GPR107 gene. GPR107 protein plays an important role in various physiological processes such as cell signaling, cell growth, and cell differentiation. In this article, we will discuss the structure, activity, and application of Recombinant Human GPR107 Protein.

Structure of Recombinant Human GPR107 Protein

The GPR107 protein is a transmembrane protein with seven alpha helices that span the cell membrane. It has a molecular weight of approximately 40 kDa and is composed of 352 amino acids. The protein has two extracellular loops, three intracellular loops, and an N-terminal and C-terminal region. The N-terminal region of GPR107 protein contains a conserved cysteine residue that is important for receptor function. The C-terminal region contains a conserved arginine residue that is involved in G protein binding.

Recombinant Human GPR107 Protein is produced by cloning the GPR107 gene into an expression vector and then expressing it in a suitable host cell. The protein is then purified using various techniques such as affinity chromatography and size-exclusion chromatography to obtain a pure and active form of the protein.

Activity of Recombinant Human GPR107 Protein

GPR107 protein belongs to the GPCR family, which is one of the largest families of proteins involved in cell signaling. These receptors are activated by a wide range of stimuli such as hormones, neurotransmitters, and light. Upon activation, GPR107 protein interacts with G proteins, which are heterotrimeric proteins consisting of α, β, and γ subunits. This interaction leads to the activation of downstream signaling pathways, resulting in various cellular responses. GPR107 protein has been shown to activate the Gαs and Gαi subunits, which are involved in the regulation of cAMP and calcium signaling pathways, respectively.

Studies have also shown that GPR107 protein plays a role in cell growth and differentiation. It has been found to be highly expressed in various cancer cells, and its overexpression has been associated with tumor growth and progression. On the other hand, downregulation of GPR107 protein has been shown to inhibit cell proliferation and induce cell death in cancer cells, making it a potential target for cancer therapy.

Application of Recombinant Human GPR107 Protein

Recombinant Human GPR107 Protein has various applications in both research and therapeutic fields. In research, it is used as a tool for studying the function of GPR107 protein and its role in various cellular processes. The recombinant protein can be used to screen for potential ligands or inhibitors of GPR107, which can help in the development of novel drugs for the treatment of diseases such as cancer.

In the therapeutic field, GPR107 protein has been identified as a potential drug target for various diseases. As mentioned earlier, its overexpression has been linked to cancer progression, making it a promising target for cancer therapy. In addition, GPR107 protein has also been found to be involved in other diseases such as diabetes, obesity, and cardiovascular disorders. Therefore, the development of drugs targeting GPR107 protein could have a significant impact on the treatment of these diseases.

In conclusion, Recombinant Human GPR107 Protein is a valuable tool for studying the structure and function of GPR107 protein. Its activity in various cellular processes and its potential as a drug target make it a promising protein for further research and therapeutic applications.

Recombinant Human GPR107 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPR107 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products