Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human JADE1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6IE81
Molecular weight:
18.48 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Gly217–Ser363
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human JADE1 Protein, N-His

Product name ARO-P10742-100
Uniprot ID Q6IE81
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKS
Molecular weight 18.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly217-Ser363
Aliases /Synonyms KIAA1807, Jade family PHD finger protein 1, JADE1, PHD finger protein 17, Protein Jade-1, PHF17
Reference ARO-P10742
Note For research use only.
Molecular Constructor
Gly217–Ser363
Product name ARO-P10742-1MG
Uniprot ID Q6IE81
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKS
Molecular weight 18.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly217-Ser363
Aliases /Synonyms KIAA1807, Jade family PHD finger protein 1, JADE1, PHD finger protein 17, Protein Jade-1, PHF17
Reference ARO-P10742
Note For research use only.
Molecular Constructor
Gly217–Ser363
Product name ARO-P10742-50
Uniprot ID Q6IE81
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKS
Molecular weight 18.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly217-Ser363
Aliases /Synonyms KIAA1807, Jade family PHD finger protein 1, JADE1, PHD finger protein 17, Protein Jade-1, PHF17
Reference ARO-P10742
Note For research use only.
Molecular Constructor
Gly217–Ser363

The Structure and Function of Recombinant Human JADE1 Protein

Recombinant proteins are proteins that are engineered in a laboratory by combining DNA sequences from different sources. These proteins have become an essential tool in the field of biotechnology and have a wide range of applications in medicine, agriculture, and research. One such recombinant protein is the human JADE1 protein, which plays a crucial role in regulating gene expression and has potential therapeutic applications.

Structure of Recombinant Human JADE1 Protein

The human JADE1 gene is located on chromosome 19 and encodes for a protein of 345 amino acids. The recombinant human JADE1 protein is produced by cloning the DNA sequence of the JADE1 gene into a suitable expression vector and expressing it in a host cell, typically E. coli or mammalian cells. The resulting protein has a molecular weight of approximately 38 kDa.

The JADE1 protein belongs to the Jade family of proteins, which also includes JADE2 and JADE3. These proteins share a conserved domain known as the Jade domain, which is responsible for their interaction with other proteins. The Jade domain is located at the C-terminus of the JADE1 protein and is essential for its function.

Function of Recombinant Human JADE1 Protein

The primary function of JADE1 protein is to regulate gene expression by acting as a transcriptional co-repressor. It does so by interacting with other proteins, such as histone deacetylases (HDACs) and histone methyltransferases (HMTs), which modify chromatin structure and regulate gene expression. JADE1 has been shown to play a crucial role in embryonic development, cell proliferation, and differentiation.

Additionally, JADE1 has been found to be involved in various cellular processes, including DNA damage response, cell cycle progression, and apoptosis. It has been shown to interact with several tumor suppressor proteins, suggesting its potential role in cancer development and progression.

Application of Recombinant Human JADE1 Protein

The recombinant human JADE1 protein has various potential applications in both research and medicine. One of the significant research applications of JADE1 is in the study of gene regulation and epigenetics. Its role as a transcriptional co-repressor makes it a valuable tool in understanding the mechanisms of gene expression and its dysregulation in diseases.

In terms of therapeutic applications, JADE1 has shown promise in cancer treatment. Studies have shown that JADE1 expression is reduced in various types of cancer, and its overexpression can inhibit tumor growth and induce cell death. This makes JADE1 a potential target for cancer therapy, and its recombinant form could be used for targeted drug delivery.

Moreover, JADE1 has also been implicated in several other diseases, such as neurodevelopmental disorders and cardiovascular diseases. Its recombinant form could be used for diagnostic purposes and as a potential therapeutic agent in these conditions.

Conclusion

In summary, the recombinant human JADE1 protein is a crucial player in regulating gene expression and has potential applications in both research and medicine. Its structure, function, and potential applications make it a valuable tool in understanding and treating various diseases. Further research and development of JADE1 could lead to the development of novel therapies for various disorders, making it an exciting area of study in the field of biotechnology.

Recombinant Human JADE1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human JADE1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products