Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BX46
Molecular weight:
22.51 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Thr11–Lys91
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep

Product name ARO-P11756-100
Uniprot ID Q9BX46
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAK
Molecular weight 22.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr11-Lys91
Aliases /Synonyms RNA-binding region-containing protein 6, RNA-binding protein 24, RNA-binding motif protein 24, RBM24, RNPC6
Reference ARO-P11756
Note For research use only.
Molecular Constructor
Thr11–Lys91
Product name ARO-P11756-1MG
Uniprot ID Q9BX46
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAK
Molecular weight 22.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr11-Lys91
Aliases /Synonyms RNA-binding region-containing protein 6, RNA-binding protein 24, RNA-binding motif protein 24, RBM24, RNPC6
Reference ARO-P11756
Note For research use only.
Molecular Constructor
Thr11–Lys91
Product name ARO-P11756-50
Uniprot ID Q9BX46
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAK
Molecular weight 22.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr11-Lys91
Aliases /Synonyms RNA-binding region-containing protein 6, RNA-binding protein 24, RNA-binding motif protein 24, RBM24, RNPC6
Reference ARO-P11756
Note For research use only.
Molecular Constructor
Thr11–Lys91

Introduction

Recombinant Human RBM24 Protein, also known as RNA-binding motif protein 24, is a vital protein that plays a crucial role in RNA processing and regulation. It is a 24-kDa protein encoded by the RBM24 gene located on chromosome 19p13.3. This protein is highly conserved among different species, indicating its essential role in various biological processes. Recombinant Human RBM24 Protein is produced through recombinant DNA technology and has a wide range of applications in research and medical fields.

Structure of Recombinant Human RBM24 Protein

The structure of Recombinant Human RBM24 Protein is composed of 215 amino acids, with a molecular weight of 24 kDa. It contains an RNA recognition motif (RRM) at its N-terminus, which is responsible for binding to RNA molecules. The RRM is a conserved domain found in many RNA-binding proteins and is crucial for their function. At the C-terminus, Recombinant Human RBM24 Protein contains a proline-rich region, which is involved in protein-protein interactions. This structure enables the protein to interact with various RNA molecules and other proteins, making it a versatile regulator of RNA processing.

Activity of Recombinant Human RBM24 Protein

The main function of Recombinant Human RBM24 Protein is to regulate RNA processing and gene expression. It binds to specific RNA sequences and modulates their splicing, stability, and translation. It is also involved in alternative splicing, a process that generates different isoforms of a protein from a single gene. This activity of Recombinant Human RBM24 Protein is crucial for the proper functioning of cells and tissues. Additionally, studies have shown that this protein is involved in the development of the heart and skeletal muscles, making it a potential target for cardiac and muscle-related disorders.

Application of Recombinant Human RBM24 Protein

Recombinant Human RBM24 Protein has a wide range of applications in research and medical fields. It is commonly used in RNA-related studies, such as RNA splicing, RNA stability, and translation regulation. Its ability to interact with various RNA molecules makes it a valuable tool for studying the function of specific RNA sequences. Moreover, Recombinant Human RBM24 Protein is also used in the development of therapeutic strategies for cardiac and muscle-related diseases. Its role in regulating gene expression and muscle development makes it a potential target for treating disorders such as muscular dystrophy and heart failure.

Recombinant Human RBM24 Protein as an Antigen

Recombinant Human RBM24 Protein has also been used as an antigen in immunological studies. It has been shown to induce a strong immune response in animals and can be used to produce specific antibodies against the protein. These antibodies can then be used in various techniques, such as Western blotting, immunofluorescence, and immunohistochemistry, to detect the presence and localization of Recombinant Human RBM24 Protein in cells and tissues. This antigen can also be used in diagnostic tests to detect the presence of autoantibodies against it, which have been associated with autoimmune diseases.

Conclusion

In conclusion, Recombinant Human RBM24 Protein is a vital protein involved in RNA processing and regulation. Its structure, activity, and application make it a versatile protein with various research and medical uses. Its role in regulating gene expression and muscle development makes it a potential target for therapeutic interventions in cardiac and muscle-related disorders. Moreover, its use as an antigen in immunological studies further highlights its importance in the field of biotechnology. Overall, Recombinant Human RBM24 Protein is a valuable tool for understanding the complex mechanisms of RNA processing and its role in various biological processes.

Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products