Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CADM3/NECL-1/TSLL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N126
Molecular weight:
35.93 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Asn25–His330
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CADM3/NECL-1/TSLL1 Protein, N-His

Product name ARO-P10727-100
Uniprot ID Q8N126
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
Molecular weight 35.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn25-His330
Aliases /Synonyms TSLL1, Immunoglobulin superfamily member 4B, Brain immunoglobulin receptor, NECL1, CADM3, Synaptic cell adhesion molecule 3, Cell adhesion molecule 3, IgSF4B, NECL-1, Nectin-like protein 1, TSLC1-like protein 1, SynCAM3, SYNCAM3, IGSF4B
Reference ARO-P10727
Note For research use only.
Molecular Constructor
Asn25–His330
Product name ARO-P10727-1MG
Uniprot ID Q8N126
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
Molecular weight 35.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn25-His330
Aliases /Synonyms TSLL1, Immunoglobulin superfamily member 4B, Brain immunoglobulin receptor, NECL1, CADM3, Synaptic cell adhesion molecule 3, Cell adhesion molecule 3, IgSF4B, NECL-1, Nectin-like protein 1, TSLC1-like protein 1, SynCAM3, SYNCAM3, IGSF4B
Reference ARO-P10727
Note For research use only.
Molecular Constructor
Asn25–His330
Product name ARO-P10727-50
Uniprot ID Q8N126
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
Molecular weight 35.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn25-His330
Aliases /Synonyms TSLL1, Immunoglobulin superfamily member 4B, Brain immunoglobulin receptor, NECL1, CADM3, Synaptic cell adhesion molecule 3, Cell adhesion molecule 3, IgSF4B, NECL-1, Nectin-like protein 1, TSLC1-like protein 1, SynCAM3, SYNCAM3, IGSF4B
Reference ARO-P10727
Note For research use only.
Molecular Constructor
Asn25–His330

Introduction

The Recombinant Human CADM3/NECL-1/TSLL1 Protein, also known as TSLC1-like protein 1, is a member of the immunoglobulin superfamily of cell adhesion molecules. It is a type I transmembrane protein that is encoded by the CADM3 gene. This protein plays a crucial role in cell adhesion, migration, and signaling, making it a valuable tool for various scientific applications.

Structure

The Recombinant Human CADM3/NECL-1/TSLL1 Protein is composed of 429 amino acids, with a predicted molecular weight of approximately 47 kDa. It contains an extracellular domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain consists of two immunoglobulin-like domains, which are responsible for mediating protein-protein interactions. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail contains signaling motifs that are involved in intracellular signaling pathways.

Activity

The Recombinant Human CADM3/NECL-1/TSLL1 Protein is a cell adhesion molecule that plays a crucial role in various cellular processes. It is primarily expressed in the brain, with high levels found in the hippocampus, amygdala, and cerebellum. This protein is involved in the formation and maintenance of synapses, which are essential for proper brain function. It also plays a role in cell migration and axon guidance, making it a critical protein in the development and maintenance of the nervous system.

Furthermore, the Recombinant Human CADM3/NECL-1/TSLL1 Protein is involved in immune responses. It is expressed on the surface of immune cells, such as T cells and natural killer cells, and plays a role in the recognition and elimination of infected or abnormal cells. It also regulates the activation and proliferation of immune cells, making it a potential target for immunotherapy.

Application

The Recombinant Human CADM3/NECL-1/TSLL1 Protein has various applications in the field of neuroscience, immunology, and cancer research. In neuroscience, it can be used to study synapse formation and function, as well as neuronal development and plasticity. It can also be used to investigate the role of cell adhesion molecules in neurological disorders such as autism and schizophrenia.

In immunology, the Recombinant Human CADM3/NECL-1/TSLL1 Protein can be used to study immune cell activation and proliferation. It can also be used to develop therapies for autoimmune diseases and cancer. The protein’s role in immune responses makes it a potential target for immunotherapy, where it can be used to modulate immune cell activity and enhance anti-tumor responses.

Additionally, the Recombinant Human CADM3/NECL-1/TSLL1 Protein can be used as an antigen in antibody production. Antibodies against this protein can be used for diagnostic purposes, such as detecting CADM3 expression in cancer cells. They can also be used in cancer treatment, where they can target and kill cancer cells expressing high levels of CADM3.

Conclusion

The Recombinant Human CADM3/NECL-1/TSLL1 Protein is a versatile protein with a wide range of applications in various scientific fields. Its role in cell adhesion, migration, and signaling makes it a valuable tool for studying various cellular processes. It also has potential applications in the development of therapies for neurological disorders, autoimmune diseases, and cancer. With its diverse functions and potential, this protein continues to be a subject of interest for many researchers and scientists.

Recombinant Human CADM3/NECL-1/TSLL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CADM3/NECL-1/TSLL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products