Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VPS8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N3P4
Molecular weight:
19.79 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Val819–Glu966
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VPS8 Protein, N-His

Product name ARO-P10728-100
Uniprot ID Q8N3P4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMVENSDFTPSQVGCLFTFLARQLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIE
Molecular weight 19.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val819-Glu966
Aliases /Synonyms VPS8, KIAA0804, Vacuolar protein sorting-associated protein 8 homolog
Reference ARO-P10728
Note For research use only.
Molecular Constructor
Val819–Glu966
Product name ARO-P10728-1MG
Uniprot ID Q8N3P4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMVENSDFTPSQVGCLFTFLARQLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIE
Molecular weight 19.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val819-Glu966
Aliases /Synonyms VPS8, KIAA0804, Vacuolar protein sorting-associated protein 8 homolog
Reference ARO-P10728
Note For research use only.
Molecular Constructor
Val819–Glu966
Product name ARO-P10728-50
Uniprot ID Q8N3P4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMVENSDFTPSQVGCLFTFLARQLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIE
Molecular weight 19.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val819-Glu966
Aliases /Synonyms VPS8, KIAA0804, Vacuolar protein sorting-associated protein 8 homolog
Reference ARO-P10728
Note For research use only.
Molecular Constructor
Val819–Glu966

Introduction

Recombinant Human VPS8 Protein, also known as Vacuolar Protein Sorting 8 Homolog (VPS8), is a protein that plays a crucial role in intracellular protein trafficking and sorting. It is a member of the VPS8 family, which is involved in the formation and maturation of endosomes, lysosomes, and autophagosomes. Recombinant VPS8 Protein is produced through genetic engineering techniques, making it a highly pure and specific protein with a wide range of applications in various fields of research and medicine.

Structure of Recombinant Human VPS8 Protein

Recombinant Human VPS8 Protein is a 102 kDa protein consisting of 925 amino acids. It contains a conserved VPS8 domain, which is responsible for its function in intracellular trafficking. The protein also has several other domains, including a coiled-coil domain, a WD40 repeat domain, and a C2 domain. These domains are essential for protein-protein interactions and membrane binding, allowing VPS8 to perform its cellular functions.

Activity of Recombinant Human VPS8 Protein

Recombinant Human VPS8 Protein is involved in the process of endosomal sorting and trafficking. It functions as a subunit of the Class C VPS complex, which is responsible for the fusion of endosomes with lysosomes and the formation of multivesicular bodies. VPS8 interacts with other subunits of the VPS complex, such as VPS11 and VPS18, to regulate the formation and maturation of endosomes and lysosomes. It also plays a role in autophagosome formation, a process that involves the degradation of cellular components through the lysosomal pathway.

Application of Recombinant Human VPS8 Protein

Recombinant Human VPS8 Protein has a wide range of applications in both research and medicine. Its role in intracellular trafficking makes it a valuable tool for studying the mechanisms of endosome and lysosome formation. It can also be used to investigate the molecular basis of diseases related to defects in these processes, such as lysosomal storage disorders and neurodegenerative diseases.

Furthermore, Recombinant Human VPS8 Protein has potential therapeutic applications. It has been identified as a potential target for cancer therapy, as it is involved in the regulation of cell growth and proliferation. Studies have shown that inhibiting VPS8 activity can lead to the death of cancer cells, making it a promising target for the development of anti-cancer drugs.

In addition, Recombinant Human VPS8 Protein has been shown to play a role in the immune response. It is a key player in the antigen processing and presentation pathway, where it helps to deliver antigens to MHC class II molecules for presentation to T cells. This makes it a potential target for the development of vaccines and immunotherapies.

Conclusion

Recombinant Human VPS8 Protein is a crucial protein involved in intracellular trafficking and sorting. Its structure and activity have been extensively studied, and it has been identified as a potential therapeutic target for various diseases. Its wide range of applications in research and medicine make it a valuable tool for understanding cellular processes and developing new treatments. With further research, Recombinant Human VPS8 Protein has the potential to make significant contributions to the fields of biology, medicine, and biotechnology.

Recombinant Human VPS8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VPS8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products