Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB4A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20338
Molecular weight:
21.53 kDa

Original price was: €392.00.Current price is: €329.00.

100ug 16% OFF + 329 loyalty points
Asp11–Gly181
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB4A Protein, N-His

Product name ARO-P11595-100
Uniprot ID P20338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESG
Molecular weight 21.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp11-Gly181
Aliases /Synonyms Ras-related protein Rab-4A, RAB4A, RAB4
Reference ARO-P11595
Note For research use only.
Molecular Constructor
Asp11–Gly181
Product name ARO-P11595-1MG
Uniprot ID P20338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESG
Molecular weight 21.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp11-Gly181
Aliases /Synonyms Ras-related protein Rab-4A, RAB4A, RAB4
Reference ARO-P11595
Note For research use only.
Molecular Constructor
Asp11–Gly181
Product name ARO-P11595-50
Uniprot ID P20338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESG
Molecular weight 21.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp11-Gly181
Aliases /Synonyms Ras-related protein Rab-4A, RAB4A, RAB4
Reference ARO-P11595
Note For research use only.
Molecular Constructor
Asp11–Gly181

Introduction to Recombinant Human RAB4A Protein

Recombinant Human RAB4A Protein is a crucial protein in the RAB family, which is involved in regulating intracellular vesicular trafficking and membrane dynamics. This protein is produced through recombinant technology, making it a valuable tool for research and therapeutic applications. In this article, we will explore the structure, activity, and potential applications of Recombinant Human RAB4A Protein.

Structure of Recombinant Human RAB4A Protein

Recombinant Human RAB4A Protein is a small GTPase, consisting of 205 amino acids with a molecular weight of 23 kDa. It belongs to the RAB family of proteins, which are involved in the transport of molecules between different compartments of the cell. The protein structure is divided into five regions: the N-terminal domain, switch I, switch II, the C-terminal domain, and the hypervariable region.

The N-terminal domain is responsible for binding to guanine nucleotides, while the switch regions are involved in the GTPase activity of the protein. The C-terminal domain is responsible for membrane localization and interaction with effector proteins. The hypervariable region is unique to each RAB protein and plays a role in determining the specificity of its function.

Activity of Recombinant Human RAB4A Protein

Recombinant Human RAB4A Protein is primarily involved in regulating endocytic trafficking, which is the process of internalizing molecules from the cell surface into the cell. It plays a crucial role in endocytic recycling, which involves the return of internalized molecules back to the cell surface. This recycling process is essential for maintaining the proper balance of molecules in the cell and for cell signaling.

RAB4A is also involved in regulating the fusion of endocytic vesicles with early endosomes, which are compartments within the cell that sort and distribute molecules to their respective destinations. It does this by interacting with other proteins, such as Rabaptin-5 and EEA1, which are involved in endosomal fusion and sorting.

Furthermore, RAB4A has been shown to play a role in regulating the activity of cell surface receptors, such as the transferrin receptor. It does this by controlling the recycling of these receptors back to the cell surface, thereby regulating their availability for ligand binding and signaling.

Applications of Recombinant Human RAB4A Protein

The use of Recombinant Human RAB4A Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study the mechanisms of endocytic trafficking and membrane dynamics. Its recombinant nature allows for easy manipulation and modification, making it a valuable tool for understanding the role of RAB4A in various cellular processes.

Additionally, Recombinant Human RAB4A Protein has potential therapeutic applications. It has been shown to play a role in various diseases, such as cancer and neurodegenerative disorders. Its involvement in regulating cell surface receptors makes it a potential target for drug development, particularly in diseases where receptor activity is dysregulated.

In conclusion, Recombinant Human RAB4A Protein is a crucial protein in the RAB family, involved in regulating intracellular vesicular trafficking and membrane dynamics. Its structure, activity, and potential applications make it a valuable tool for research and a potential target for therapeutic interventions. Further studies on this protein will provide a better understanding of its role in cellular processes and its potential for therapeutic use.

Recombinant Human RAB4A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB4A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products