Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADIPOR2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86V24
Molecular weight:
19.33 kDa

Original price was: €276.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Met1–Gly147
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADIPOR2, N-His

Product name ARO-P13269-100
Uniprot ID Q86V24
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Molecular weight 19.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly147
Aliases /Synonyms Adiponectin receptor protein 2, ADIPOR2, PAQR2, Progestin and adipoQ receptor family member 2, Progestin and adipoQ receptor family member II
Reference ARO-P13269
Note For research use only.
Molecular Constructor
Met1–Gly147
Product name ARO-P13269-1MG
Uniprot ID Q86V24
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Molecular weight 19.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly147
Aliases /Synonyms Adiponectin receptor protein 2, ADIPOR2, PAQR2, Progestin and adipoQ receptor family member 2, Progestin and adipoQ receptor family member II
Reference ARO-P13269
Note For research use only.
Molecular Constructor
Met1–Gly147
Product name ARO-P13269-50
Uniprot ID Q86V24
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Molecular weight 19.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly147
Aliases /Synonyms Adiponectin receptor protein 2, ADIPOR2, PAQR2, Progestin and adipoQ receptor family member 2, Progestin and adipoQ receptor family member II
Reference ARO-P13269
Note For research use only.
Molecular Constructor
Met1–Gly147

Introduction

Recombinant proteins, also known as genetically engineered proteins, are proteins that are produced through the use of recombinant DNA technology. These proteins have a wide range of applications in various fields such as medicine, biotechnology, and research. One such protein is Recombinant Human ADIPOR2, which has gained significant attention in recent years due to its unique structure and potential therapeutic applications.

Structure of Recombinant Human ADIPOR2

Recombinant Human ADIPOR2 is a transmembrane protein that belongs to the adiponectin receptor family. It is encoded by the ADIPOR2 gene located on chromosome 12 in humans. The protein consists of 375 amino acids and has a molecular weight of approximately 42 kDa. It is composed of an extracellular N-terminal domain, seven transmembrane domains, and an intracellular C-terminal domain.

The extracellular domain of Recombinant Human ADIPOR2 contains a cysteine-rich region and a fibronectin type III domain. These domains are involved in ligand binding and receptor activation. The transmembrane domains are responsible for anchoring the protein to the cell membrane, while the intracellular domain plays a crucial role in signal transduction.

Activity of Recombinant Human ADIPOR2

Recombinant Human ADIPOR2 is a receptor for adiponectin, a hormone secreted by adipose tissue that regulates glucose and lipid metabolism. Upon binding to adiponectin, the receptor undergoes conformational changes, leading to the activation of downstream signaling pathways. These pathways include the AMP-activated protein kinase (AMPK) pathway, which plays a crucial role in energy homeostasis, and the peroxisome proliferator-activated receptor (PPAR) pathway, which is involved in lipid metabolism.

Furthermore, Recombinant Human ADIPOR2 has been shown to interact with other proteins, such as APPL1 and APPL2, which are involved in insulin signaling and glucose uptake. This interaction suggests a potential role of Recombinant Human ADIPOR2 in regulating glucose metabolism and insulin sensitivity.

Application of Recombinant Human ADIPOR2

The unique structure and activity of Recombinant Human ADIPOR2 make it a promising target for therapeutic interventions. One potential application is in the treatment of metabolic disorders, such as type 2 diabetes and obesity. Studies have shown that adiponectin signaling through ADIPOR2 can improve insulin sensitivity and glucose uptake, making it a potential target for developing new anti-diabetic drugs.

Another potential application is in cancer therapy. Adiponectin has been shown to have anti-tumor effects, and Recombinant Human ADIPOR2 could play a role in mediating these effects. Additionally, the interaction of ADIPOR2 with APPL1 and APPL2 suggests a potential role in regulating cell proliferation and survival, making it a potential target for cancer treatment.

Furthermore, Recombinant Human ADIPOR2 has been shown to have anti-inflammatory effects, making it a potential target for the treatment of inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease.

Conclusion

In conclusion, Recombinant Human ADIPOR2 is a transmembrane protein with a unique structure and activity. Its role as a receptor for adiponectin and its potential involvement in various signaling pathways make it a promising target for therapeutic interventions. Further research on this protein could lead to the development of new treatments for metabolic disorders, cancer, and inflammatory diseases.

Recombinant Human ADIPOR2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ADIPOR2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products