Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GDF7, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q7Z4P5
Molecular weight:
16.32 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Thr322–Arg450
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GDF7, N-His

Product name ARO-P13274-100
Uniprot ID Q7Z4P5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular weight 16.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr322-Arg450
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P13274
Note For research use only.
Molecular Constructor
Thr322–Arg450
Product name ARO-P13274-1MG
Uniprot ID Q7Z4P5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular weight 16.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr322-Arg450
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P13274
Note For research use only.
Molecular Constructor
Thr322–Arg450
Product name ARO-P13274-50
Uniprot ID Q7Z4P5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular weight 16.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr322-Arg450
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P13274
Note For research use only.
Molecular Constructor
Thr322–Arg450

Introduction to Recombinant Human GDF7

Recombinant Human GDF7 (Growth Differentiation Factor 7) is a protein that belongs to the transforming growth factor-beta (TGF-β) superfamily. It is a homodimeric protein that is composed of two identical subunits, each containing 119 amino acids. This protein is encoded by the GDF7 gene and is also known as BMP-12 (Bone Morphogenetic Protein 12).

Structure of Recombinant Human GDF7

Recombinant Human GDF7 is a small protein with a molecular weight of approximately 27 kDa. It has a highly conserved structure among different species, with 97% amino acid sequence identity between human and mouse GDF7. The protein is composed of a signal peptide, a propeptide, and a mature domain. The mature domain is responsible for the biological activity of GDF7 and is further divided into two subdomains: the N-terminal and C-terminal subdomains.

The N-terminal subdomain of GDF7 contains seven cysteine residues that form disulfide bonds, which are important for the stability and proper folding of the protein. The C-terminal subdomain, on the other hand, contains a conserved motif called the TGF-β homology domain, which is responsible for the binding of GDF7 to its receptors.

Activity of Recombinant Human GDF7

Recombinant Human GDF7 is a multifunctional protein that plays a crucial role in various biological processes, including cell proliferation, differentiation, and tissue regeneration. It exerts its effects by binding to specific cell surface receptors, known as type I and type II receptors. Upon binding, the receptors undergo conformational changes, leading to the activation of downstream signaling pathways, such as the SMAD pathway.

One of the main functions of GDF7 is its ability to promote the differentiation of mesenchymal stem cells (MSCs) into chondrocytes, which are the cells responsible for the production of cartilage. This makes GDF7 a promising therapeutic agent for the treatment of cartilage-related diseases, such as osteoarthritis.

In addition, GDF7 has been shown to stimulate the growth and differentiation of muscle cells, making it a potential candidate for the treatment of muscle injuries or disorders. It also has a role in bone formation, as it has been found to promote the proliferation and differentiation of osteoblasts, which are responsible for bone formation.

Application of Recombinant Human GDF7

Recombinant Human GDF7 has a wide range of potential applications in the field of regenerative medicine and tissue engineering. Its ability to promote chondrogenesis and osteogenesis makes it a promising candidate for the repair and regeneration of damaged cartilage and bone tissue. It has also been studied for its potential in promoting the healing of muscle injuries and improving muscle function.

In addition, GDF7 has been investigated for its role in promoting wound healing and tissue repair. Studies have shown that GDF7 can stimulate the growth and migration of fibroblasts, which are crucial for wound healing. It has also been found to enhance the production of extracellular matrix proteins, which are essential for tissue repair.

Furthermore, the use of recombinant GDF7 in combination with other growth factors or scaffolds has been explored for the development of tissue-engineered constructs for various applications, such as bone and cartilage repair.

Conclusion

Recombinant Human GDF7 is a small but powerful protein with diverse biological functions. Its structure, activity, and potential applications make it a promising candidate for the development of novel therapeutics in the field of regenerative medicine and tissue engineering. Further research and clinical trials are needed to fully understand the potential of this protein and its role in various diseases and conditions.

Recombinant Human GDF7, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GDF7, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products