Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PROX1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92786
Molecular weight:
24.51 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Thr546–His736
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PROX1, N-His

Product name ARO-P13205-100
Uniprot ID Q92786
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH
Molecular weight 24.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr546-His736
Aliases /Synonyms PROX1, Prospero homeobox protein 1, PROX-1, Homeobox prospero-like protein PROX1
Reference ARO-P13205
Note For research use only.
Molecular Constructor
Thr546–His736
Product name ARO-P13205-1MG
Uniprot ID Q92786
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH
Molecular weight 24.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr546-His736
Aliases /Synonyms PROX1, Prospero homeobox protein 1, PROX-1, Homeobox prospero-like protein PROX1
Reference ARO-P13205
Note For research use only.
Molecular Constructor
Thr546–His736
Product name ARO-P13205-50
Uniprot ID Q92786
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH
Molecular weight 24.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr546-His736
Aliases /Synonyms PROX1, Prospero homeobox protein 1, PROX-1, Homeobox prospero-like protein PROX1
Reference ARO-P13205
Note For research use only.
Molecular Constructor
Thr546–His736

Introduction

Recombinant Human PROX1 is a protein that plays a crucial role in the development and maintenance of various tissues and organs in the human body. It is a transcription factor that regulates the expression of genes involved in cell differentiation, proliferation, and survival. In this article, we will explore the structure, activity, and application of this important protein.

Structure of Recombinant Human PROX1

Recombinant Human PROX1 is a 737 amino acid protein with a molecular weight of approximately 83 kDa. It consists of several functional domains, including a DNA-binding homeodomain, a Prospero domain, and a C-terminal transactivation domain. The homeodomain is responsible for DNA binding, while the Prospero domain is involved in protein-protein interactions. The transactivation domain is responsible for activating the expression of target genes.

Activity of Recombinant Human PROX1

The main activity of Recombinant Human PROX1 is its role as a transcription factor. It binds to specific DNA sequences and regulates the expression of target genes. This activity is essential for the development and maintenance of various tissues and organs, including the liver, lymphatic system, and eyes.

Studies have shown that Recombinant Human PROX1 is necessary for the development of the liver. It regulates the expression of genes involved in liver cell differentiation and function, and its absence leads to severe liver defects. Additionally, Recombinant Human PROX1 is crucial for the development of the lymphatic system. It controls the expression of genes involved in lymphatic vessel formation and function, and its absence leads to lymphatic disorders.

Furthermore, Recombinant Human PROX1 is also involved in eye development. It regulates the expression of genes involved in eye cell differentiation and function, and its absence leads to eye defects.

Application of Recombinant Human PROX1

Recombinant Human PROX1 has various applications in both research and medicine. One of its main applications is in studying the development and function of different tissues and organs. By manipulating the expression of Recombinant Human PROX1, researchers can better understand its role in various biological processes.

In medicine, Recombinant Human PROX1 has potential therapeutic applications. For example, it can be used to treat liver disorders by promoting liver cell differentiation and function. It can also be used to treat lymphatic disorders by promoting lymphatic vessel formation and function. Additionally, Recombinant Human PROX1 can be used in gene therapy to correct genetic defects that affect its expression and function.

Conclusion

In conclusion, Recombinant Human PROX1 is a crucial protein involved in the development and maintenance of various tissues and organs in the human body. Its structure, activity, and application make it an essential protein for both research and medicine. Further studies on Recombinant Human PROX1 may lead to new insights and potential therapeutic interventions for various diseases and disorders.

Recombinant Human PROX1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PROX1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products