Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NUMA1/NMP-22 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14980
Molecular weight:
19.76 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Met1–Lys153
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NUMA1/NMP-22 Protein, N-His

Product name ARO-P12755-100
Uniprot ID Q14980
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Molecular weight 19.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys153
Aliases /Synonyms SP-H antigen, NMP-22, Nuclear matrix protein-22, NMP22, NuMA protein, Nuclear mitotic apparatus protein, NUMA, Nuclear mitotic apparatus protein 1, NUMA1
Reference ARO-P12755
Note For research use only.
Molecular Constructor
Met1–Lys153
Product name ARO-P12755-1MG
Uniprot ID Q14980
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Molecular weight 19.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys153
Aliases /Synonyms SP-H antigen, NMP-22, Nuclear matrix protein-22, NMP22, NuMA protein, Nuclear mitotic apparatus protein, NUMA, Nuclear mitotic apparatus protein 1, NUMA1
Reference ARO-P12755
Note For research use only.
Molecular Constructor
Met1–Lys153
Product name ARO-P12755-50
Uniprot ID Q14980
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Molecular weight 19.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys153
Aliases /Synonyms SP-H antigen, NMP-22, Nuclear matrix protein-22, NMP22, NuMA protein, Nuclear mitotic apparatus protein, NUMA, Nuclear mitotic apparatus protein 1, NUMA1
Reference ARO-P12755
Note For research use only.
Molecular Constructor
Met1–Lys153

Introduction

Recombinant Human NUMA1/NMP-22 Protein is a highly specific and sensitive antigen used in various scientific and medical applications. It is a recombinant protein produced through genetic engineering techniques and has a wide range of uses due to its unique structure and activity.

Structure of Recombinant Human NUMA1/NMP-22 Protein

The recombinant protein is a fusion protein consisting of two domains – the N-terminal domain of human NUMA1 (nuclear mitotic apparatus protein 1) and the C-terminal domain of human NMP-22 (nuclear matrix protein 22). The two domains are joined by a flexible linker peptide, resulting in a single protein with a molecular weight of approximately 95 kDa.

The N-terminal domain of NUMA1 is responsible for the protein’s localization to the mitotic spindle during cell division, while the C-terminal domain of NMP-22 is involved in DNA binding and chromatin organization. The fusion of these two domains in the recombinant protein allows for its specific binding to certain cellular structures and molecules.

Activity of Recombinant Human NUMA1/NMP-22 Protein

The recombinant protein has multiple activities, making it a valuable tool in various research and diagnostic applications. Its primary function is as an antigen, specifically recognized by antibodies in the serum of patients with bladder cancer. This makes it a useful biomarker for the early detection of bladder cancer.

In addition to its role as an antigen, the recombinant protein also has DNA-binding activity, similar to the native NMP-22 protein. This allows for its use in chromatin immunoprecipitation (ChIP) assays, where it can be used to identify DNA sequences that are bound by specific proteins. It can also be used in protein-protein interaction studies, as it has been shown to interact with other nuclear proteins involved in cell division and DNA repair.

Applications of Recombinant Human NUMA1/NMP-22 Protein

The recombinant protein has a wide range of applications in both research and clinical settings. Its most important application is in the early detection of bladder cancer. It is used in the NMP-22 BladderChek test, a non-invasive urine test that detects the presence of NMP-22 protein in the urine. This test is highly sensitive and specific, making it a valuable tool for the early detection of bladder cancer.

Aside from bladder cancer detection, the recombinant protein is also used in research studies to investigate its role in cell division and DNA repair. Its DNA-binding activity allows for the identification of specific DNA sequences and its protein-protein interaction capabilities make it a useful tool in studying protein complexes involved in these processes.

Furthermore, the recombinant protein has potential applications in drug discovery and development. Its unique structure and activity make it a potential target for drug development, particularly in the treatment of bladder cancer and other diseases involving cell division and DNA repair.

Conclusion

In summary, Recombinant Human NUMA1/NMP-22 Protein is a valuable tool in scientific and medical research, with its specific structure, activity, and applications. Its use as an antigen in the early detection of bladder cancer, as well as its potential in drug development and research studies, make it an important protein in the field of biology and medicine.

Recombinant Human NUMA1/NMP-22 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NUMA1/NMP-22 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products