Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PMP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02689
Molecular weight:
17.07 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Met1–Val132
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PMP2 Protein, N-His

Product name ARO-P12276-100
Uniprot ID P02689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Molecular weight 17.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val132
Aliases /Synonyms PMP2, Myelin P2 protein, Peripheral myelin protein 2
Reference ARO-P12276
Note For research use only.
Molecular Constructor
Met1–Val132
Product name ARO-P12276-1MG
Uniprot ID P02689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Molecular weight 17.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val132
Aliases /Synonyms PMP2, Myelin P2 protein, Peripheral myelin protein 2
Reference ARO-P12276
Note For research use only.
Molecular Constructor
Met1–Val132
Product name ARO-P12276-50
Uniprot ID P02689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Molecular weight 17.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val132
Aliases /Synonyms PMP2, Myelin P2 protein, Peripheral myelin protein 2
Reference ARO-P12276
Note For research use only.
Molecular Constructor
Met1–Val132

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools for various scientific applications. One such protein is the Recombinant Human PMP2 Protein, which has gained significant attention due to its unique structure, diverse activities, and potential applications.

Structure of Recombinant Human PMP2 Protein

The Recombinant Human PMP2 Protein, also known as Peripheral Myelin Protein 2, is a 17 kDa protein that is encoded by the PMP2 gene. It is a member of the small hydrophobic protein family and is primarily expressed in the peripheral nervous system. The protein consists of 160 amino acids and has a single transmembrane domain, which is responsible for its association with the myelin sheath.

The crystal structure of Recombinant Human PMP2 Protein has been determined, revealing a compact globular structure with a four-helix bundle. The protein has a hydrophobic core and a positively charged surface, which enables its interaction with other proteins and lipids. This unique structure plays a crucial role in the protein’s function and activity.

Activity of Recombinant Human PMP2 Protein

Recombinant Human PMP2 Protein is primarily involved in the formation and maintenance of the myelin sheath, a protective layer surrounding nerve fibers. It is essential for the proper functioning of the nervous system and is crucial for nerve impulse transmission.

Studies have shown that Recombinant Human PMP2 Protein has a high affinity for lipids, particularly cholesterol and sphingomyelin, which are major components of the myelin sheath. The protein is also involved in the transport and organization of lipids within the myelin sheath, contributing to its stability and integrity.

In addition to its role in myelin formation, Recombinant Human PMP2 Protein has also been shown to have antioxidant properties. It can scavenge free radicals and protect cells from oxidative stress, making it a potential therapeutic agent for neurodegenerative diseases.

Applications of Recombinant Human PMP2 Protein

The unique structure and diverse activities of Recombinant Human PMP2 Protein make it a valuable tool for various scientific applications. One of its primary applications is in the study of myelin-related diseases, such as multiple sclerosis and Charcot-Marie-Tooth disease. The protein can be used to understand the role of myelin in these diseases and develop potential treatments.

Recombinant Human PMP2 Protein is also used in the development of diagnostic tests for myelin-related disorders. Its ability to interact with lipids and form stable complexes makes it a useful antigen for antibody production. These antibodies can then be used to detect the presence of the protein in biological samples, aiding in the diagnosis of myelin disorders.

Furthermore, Recombinant Human PMP2 Protein has potential applications in the field of biotechnology. It can be used as a carrier protein for drug delivery, as its hydrophobic core can accommodate small molecules. The protein can also be used in the production of artificial myelin sheaths for nerve regeneration and repair.

Conclusion

In summary, Recombinant Human PMP2 Protein is a versatile protein with a unique structure and diverse activities. Its role in myelin formation and potential applications in disease diagnosis and treatment make it a valuable tool in the scientific community. Further research on this protein may reveal even more potential applications and contribute to our understanding of the nervous system.

Recombinant Human PMP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PMP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products