Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MPZL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60487
Molecular weight:
15.87 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Ala26–Thr145
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MPZL2 Protein, N-His

Product name ARO-P12216-100
Uniprot ID O60487
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHT
Molecular weight 15.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala26-Thr145
Aliases /Synonyms EVA1, MPZL2, Epithelial V-like antigen 1, EVA, Myelin protein zero-like protein 2
Reference ARO-P12216
Note For research use only.
Molecular Constructor
Ala26–Thr145
Product name ARO-P12216-1MG
Uniprot ID O60487
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHT
Molecular weight 15.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala26-Thr145
Aliases /Synonyms EVA1, MPZL2, Epithelial V-like antigen 1, EVA, Myelin protein zero-like protein 2
Reference ARO-P12216
Note For research use only.
Molecular Constructor
Ala26–Thr145
Product name ARO-P12216-50
Uniprot ID O60487
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHT
Molecular weight 15.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala26-Thr145
Aliases /Synonyms EVA1, MPZL2, Epithelial V-like antigen 1, EVA, Myelin protein zero-like protein 2
Reference ARO-P12216
Note For research use only.
Molecular Constructor
Ala26–Thr145

Introduction to Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein is a synthetic protein that is produced through genetic engineering techniques. It is a member of the MPZL family of proteins and is also known as Myelin protein zero-like 2. This protein is primarily found in the nervous system and plays a crucial role in cell adhesion and signaling.

Structure of Recombinant Human MPZL2 Protein

The recombinant form of MPZL2 is a 33 kDa protein composed of 296 amino acids. It contains a single transmembrane domain and two extracellular immunoglobulin-like domains. The extracellular domains are responsible for mediating cell adhesion and signaling through interactions with other proteins.

Activity of Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein is involved in various cellular processes, including cell adhesion, migration, and differentiation. It is primarily expressed in the nervous system, where it plays a critical role in the formation and maintenance of myelin sheaths. Myelin sheaths are a protective layer that surrounds nerve cells and facilitates the transmission of nerve impulses.

MPZL2 is also expressed in other tissues, such as the skin and immune cells, where it is involved in cell adhesion and signaling. It has been shown to interact with other proteins, including integrins and growth factor receptors, to regulate cell adhesion and migration.

Application of Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein has various applications in both research and clinical settings. In research, it is commonly used as a tool to study cell adhesion and signaling processes. Its ability to interact with other proteins makes it a valuable tool for understanding the mechanisms of various cellular processes.

In a clinical setting, Recombinant Human MPZL2 Protein has potential applications in the treatment of nerve-related disorders. As it is involved in the formation and maintenance of myelin sheaths, it may be beneficial in treating diseases that affect the nervous system, such as multiple sclerosis and peripheral neuropathies.

Recombinant Human MPZL2 Protein as an Antigen

Recombinant Human MPZL2 Protein has also been studied as a potential antigen for vaccine development. As it is expressed in various tissues and is involved in cell adhesion and signaling, it has the potential to elicit an immune response. This immune response could be harnessed to develop vaccines against diseases that involve cell adhesion and migration, such as cancer.

Conclusion

In summary, Recombinant Human MPZL2 Protein is a synthetic protein that plays a crucial role in cell adhesion and signaling. Its structure, activity, and potential applications make it a valuable tool in both research and clinical settings. Further studies on this protein may lead to a better understanding of its role in various cellular processes and potential therapeutic applications.

Recombinant Human MPZL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MPZL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products