Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MMP28 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H239
Molecular weight:
24.99 kDa

Original price was: €378.00.Current price is: €329.00.

100ug 13% OFF + 329 loyalty points
Lys322–Phe520
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MMP28 Protein, N-His

Product name ARO-P12223-100
Uniprot ID Q9H239
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Molecular weight 24.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys322-Phe520
Aliases /Synonyms MMP-28, Epilysin, MMP28, MMP25, Matrix metalloproteinase-28
Reference ARO-P12223
Note For research use only.
Molecular Constructor
Lys322–Phe520
Product name ARO-P12223-1MG
Uniprot ID Q9H239
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Molecular weight 24.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys322-Phe520
Aliases /Synonyms MMP-28, Epilysin, MMP28, MMP25, Matrix metalloproteinase-28
Reference ARO-P12223
Note For research use only.
Molecular Constructor
Lys322–Phe520
Product name ARO-P12223-50
Uniprot ID Q9H239
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Molecular weight 24.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys322-Phe520
Aliases /Synonyms MMP-28, Epilysin, MMP28, MMP25, Matrix metalloproteinase-28
Reference ARO-P12223
Note For research use only.
Molecular Constructor
Lys322–Phe520

Introduction to Recombinant Human MMP28 Protein

Recombinant Human Matrix Metalloproteinase 28 (MMP28) is a protein that plays a crucial role in various physiological and pathological processes. It is a member of the matrix metalloproteinase family, which consists of enzymes that are involved in the breakdown of extracellular matrix components. MMP28 is also known as epilysin, matrilysin-2, or metalloproteinase-28, and it is encoded by the MMP28 gene located on chromosome 19 in humans.

Structure of Recombinant Human MMP28 Protein

Recombinant Human MMP28 Protein is a 57-kDa protein that is composed of 490 amino acids. It contains a signal peptide, a prodomain, a catalytic domain, a hinge region, and a hemopexin-like domain. The catalytic domain is responsible for the proteolytic activity of MMP28, while the hemopexin-like domain is involved in substrate binding. The prodomain is important for the regulation of MMP28 activity, as it needs to be cleaved to activate the enzyme. The hinge region provides flexibility to the protein, allowing it to interact with different substrates.

Activity of Recombinant Human MMP28 Protein

Recombinant Human MMP28 Protein is a zinc-dependent endopeptidase that is primarily involved in the degradation of extracellular matrix proteins such as collagen, fibronectin, and laminin. It is expressed in various tissues, including the skin, lung, and reproductive organs. MMP28 has been shown to play a role in tissue remodeling, wound healing, and immune response. It also has a role in cancer progression and metastasis, as it can promote tumor invasion and angiogenesis.

The activity of MMP28 is tightly regulated by various mechanisms. The prodomain of MMP28 needs to be cleaved to activate the enzyme, and this can be done by other MMPs or by extracellular proteases such as plasmin. In addition, the activity of MMP28 can be inhibited by tissue inhibitors of metalloproteinases (TIMPs) and other endogenous inhibitors. This tight regulation ensures that MMP28 is only active when needed and prevents excessive degradation of the extracellular matrix.

Application of Recombinant Human MMP28 Protein

Recombinant Human MMP28 Protein has various applications in both research and clinical settings. In research, it is commonly used as a tool to study the role of MMP28 in different physiological and pathological processes. It can be used to investigate the role of MMP28 in tissue development, wound healing, and immune response. In addition, recombinant MMP28 can be used to identify potential substrates and inhibitors for this enzyme.

In the clinical setting, recombinant MMP28 has potential applications in the diagnosis and treatment of various diseases. Due to its involvement in cancer progression, MMP28 has been proposed as a potential biomarker for cancer diagnosis and prognosis. In addition, MMP28 inhibitors are being developed as potential therapeutics for cancer and other diseases where MMP28 plays a role, such as arthritis and cardiovascular diseases.

Conclusion

In summary, Recombinant Human MMP28 Protein is a 57-kDa protein that plays a crucial role in tissue remodeling, wound healing, and immune response. It is composed of a signal peptide, prodomain, catalytic domain, hinge region, and hemopexin-like domain. The activity of MMP28 is tightly regulated by various mechanisms, and it has potential applications in both research and clinical settings. Further studies on this enzyme may lead to a better understanding of its role in health and disease and the development of novel therapeutics.

Recombinant Human MMP28 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MMP28 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products