Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLAGL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPG8
Molecular weight:
22.48 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Ser81–Thr251
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLAGL2 Protein, N-His

Product name ARO-P12080-100
Uniprot ID Q9UPG8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKT
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser81-Thr251
Aliases /Synonyms KIAA0198, PLAGL2, Zinc finger protein PLAGL2, Pleiomorphic adenoma-like protein 2
Reference ARO-P12080
Note For research use only.
Molecular Constructor
Ser81–Thr251
Product name ARO-P12080-1MG
Uniprot ID Q9UPG8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKT
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser81-Thr251
Aliases /Synonyms KIAA0198, PLAGL2, Zinc finger protein PLAGL2, Pleiomorphic adenoma-like protein 2
Reference ARO-P12080
Note For research use only.
Molecular Constructor
Ser81–Thr251
Product name ARO-P12080-50
Uniprot ID Q9UPG8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKT
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser81-Thr251
Aliases /Synonyms KIAA0198, PLAGL2, Zinc finger protein PLAGL2, Pleiomorphic adenoma-like protein 2
Reference ARO-P12080
Note For research use only.
Molecular Constructor
Ser81–Thr251

Introduction

Recombinant Human PLAGL2 Protein, also known as pleiomorphic adenoma gene-like 2 protein, is a key transcription factor that plays a crucial role in various cellular processes such as cell proliferation, differentiation, and apoptosis. This protein is encoded by the PLAGL2 gene and is highly conserved among different species, including humans.

Structure of Recombinant Human PLAGL2 Protein

The recombinant human PLAGL2 protein is a 54 kDa protein consisting of 490 amino acids. It contains a highly conserved zinc finger domain at the C-terminus, which is essential for its DNA binding and transcriptional activation functions. This protein also has a proline-rich region at the N-terminus, which is involved in protein-protein interactions.

Activity of Recombinant Human PLAGL2 Protein

Recombinant human PLAGL2 protein is a transcription factor that regulates gene expression by binding to specific DNA sequences in the promoter regions of target genes. It can act as both a transcriptional activator and repressor, depending on the target gene and the cellular context. PLAGL2 has been shown to interact with various transcriptional co-regulators, such as p300 and CBP, to modulate gene expression.

One of the key functions of PLAGL2 is its role in cell proliferation. Studies have shown that this protein promotes cell cycle progression by activating the expression of cell cycle regulators, such as cyclin D1 and cyclin-dependent kinase 4 (CDK4). PLAGL2 has also been implicated in cell differentiation processes, where it can act as a transcriptional repressor to inhibit the expression of differentiation-associated genes.

Moreover, PLAGL2 has been shown to play a crucial role in apoptosis, or programmed cell death. It has been reported to induce apoptosis in various cancer cell lines by activating the expression of pro-apoptotic genes and inhibiting the expression of anti-apoptotic genes. This suggests that PLAGL2 may have a potential role in cancer therapy.

Application of Recombinant Human PLAGL2 Protein

Recombinant human PLAGL2 protein has a wide range of applications in both basic research and clinical settings. Its role in cell proliferation and differentiation makes it a valuable tool for studying these processes in various cell types. PLAGL2 can also be used to investigate the mechanisms of gene regulation and transcriptional control.

In cancer research, PLAGL2 has emerged as a potential therapeutic target due to its involvement in cell proliferation and apoptosis. Recombinant human PLAGL2 protein can be used to study the effects of PLAGL2 inhibition in cancer cells and to develop novel anti-cancer therapies targeting this protein.

Furthermore, PLAGL2 has been identified as a potential diagnostic and prognostic marker for various cancers, including breast, lung, and colon cancer. Recombinant human PLAGL2 protein can be used in diagnostic tests to detect the expression levels of PLAGL2 in patient samples, which may help in early cancer detection and personalized treatment strategies.

Conclusion

In summary, recombinant human PLAGL2 protein is a crucial transcription factor involved in various cellular processes, including cell proliferation, differentiation, and apoptosis. Its structure, activity, and applications make it a valuable tool for both basic research and clinical applications. Further studies on PLAGL2 may provide insights into its potential as a therapeutic target and diagnostic marker for various diseases, particularly cancer.

Recombinant Human PLAGL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLAGL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products