Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human OPTN Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96CV9
Molecular weight:
40.77 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Ser415–Arg524
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human OPTN Protein, N-GST & C-His

Product name ARO-P12618-100
Uniprot ID Q96CV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGAR
Molecular weight 40.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser415-Arg524
Aliases /Synonyms NRP, TFIIIA-IntP, Huntingtin-interacting protein 7, HIP-7, Huntingtin yeast partner L, Transcription factor IIIA-interacting protein, NEMO-related protein, E3-14.7K-interacting protein, GLC1E, HIP7, HYPL, FIP-2, Huntingtin-interacting protein L, Optic neuropathy-inducing protein, OPTN, Optineurin, FIP2
Reference ARO-P12618
Note For research use only.
Molecular Constructor
Ser415–Arg524
Product name ARO-P12618-1MG
Uniprot ID Q96CV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGAR
Molecular weight 40.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser415-Arg524
Aliases /Synonyms NRP, TFIIIA-IntP, Huntingtin-interacting protein 7, HIP-7, Huntingtin yeast partner L, Transcription factor IIIA-interacting protein, NEMO-related protein, E3-14.7K-interacting protein, GLC1E, HIP7, HYPL, FIP-2, Huntingtin-interacting protein L, Optic neuropathy-inducing protein, OPTN, Optineurin, FIP2
Reference ARO-P12618
Note For research use only.
Molecular Constructor
Ser415–Arg524
Product name ARO-P12618-50
Uniprot ID Q96CV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGAR
Molecular weight 40.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser415-Arg524
Aliases /Synonyms NRP, TFIIIA-IntP, Huntingtin-interacting protein 7, HIP-7, Huntingtin yeast partner L, Transcription factor IIIA-interacting protein, NEMO-related protein, E3-14.7K-interacting protein, GLC1E, HIP7, HYPL, FIP-2, Huntingtin-interacting protein L, Optic neuropathy-inducing protein, OPTN, Optineurin, FIP2
Reference ARO-P12618
Note For research use only.
Molecular Constructor
Ser415–Arg524

Introduction to Recombinant Human OPTN Protein

Recombinant Human OPTN Protein is a highly versatile and valuable tool in the field of biotechnology. It is a protein that is produced through genetic engineering techniques, specifically recombinant DNA technology. This allows for the production of large quantities of the protein in a controlled and efficient manner. Recombinant Human OPTN Protein has a unique structure and diverse range of activities, making it an essential component in various scientific research and applications.

Structure of Recombinant Human OPTN Protein

Recombinant Human OPTN Protein is a 70 kDa protein that consists of 577 amino acids. It is composed of several functional domains, including an N-terminal ubiquitin-binding domain, a coiled-coil domain, and a C-terminal zinc finger domain. These domains play important roles in the protein’s function and interactions with other molecules.

The N-terminal ubiquitin-binding domain of Recombinant Human OPTN Protein is responsible for its ability to bind to ubiquitin, a small protein involved in various cellular processes such as protein degradation and DNA repair. This domain also contains a ubiquitin-associated (UBA) motif, which is essential for the protein’s interaction with ubiquitin and its subsequent function.

The coiled-coil domain of Recombinant Human OPTN Protein is involved in protein-protein interactions, specifically with other proteins containing coiled-coil domains. This allows for the formation of protein complexes and the regulation of various cellular processes.

The C-terminal zinc finger domain of Recombinant Human OPTN Protein is responsible for its ability to bind to zinc ions. This domain is important for the protein’s stability and function, as well as its interactions with other molecules.

Activity of Recombinant Human OPTN Protein

Recombinant Human OPTN Protein has a wide range of activities, making it a valuable tool in various scientific research and applications. One of its main functions is its role in autophagy, a cellular process that involves the degradation and recycling of damaged or unnecessary cellular components. Recombinant Human OPTN Protein is involved in the formation of autophagosomes, which are specialized structures that carry out the process of autophagy.

In addition to its role in autophagy, Recombinant Human OPTN Protein is also involved in the regulation of inflammation and immune responses. It has been shown to interact with various proteins involved in these processes, suggesting its potential as a therapeutic target for diseases involving dysregulated inflammation and immune responses.

Furthermore, Recombinant Human OPTN Protein has been found to play a role in the maintenance of cellular homeostasis and the regulation of cell death. It has been linked to various cellular processes such as cell growth, proliferation, and survival, highlighting its importance in maintaining the overall health and function of cells.

Application of Recombinant Human OPTN Protein

Recombinant Human OPTN Protein has numerous applications in the field of biotechnology and medicine. Its role in autophagy makes it a valuable tool for studying this cellular process and its involvement in various diseases. It can also be used to study the interactions between proteins involved in autophagy, providing insights into the underlying mechanisms of this process.

Additionally, the diverse activities of Recombinant Human OPTN Protein make it a potential therapeutic target for various diseases. Its involvement in inflammation and immune responses makes it a promising target for the development of treatments for inflammatory and autoimmune diseases. Its role in maintaining cellular homeostasis and regulating cell death also makes it a potential target for diseases involving dysregulated cellular processes.

In conclusion, Recombinant Human OPTN Protein is a highly valuable and versatile tool in the field of biotechnology. Its unique structure and diverse range of activities make it an essential component in various scientific research and applications. With its potential as a therapeutic target, Recombinant Human OPTN Protein holds promise for the development of treatments for various diseases

Recombinant Human OPTN Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human OPTN Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products