Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WASL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O00401
Molecular weight:
17.16 kDa

Original price was: €265.00.Current price is: €230.00.

50ug 13% OFF + 230 loyalty points
Leu21–Arg148
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WASL Protein, N-His

Product name ARO-P12086-100
Uniprot ID O00401
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKR
Molecular weight 17.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu21-Arg148
Aliases /Synonyms N-WASP, WASL, Neural Wiskott-Aldrich syndrome protein
Reference ARO-P12086
Note For research use only.
Molecular Constructor
Leu21–Arg148
Product name ARO-P12086-1MG
Uniprot ID O00401
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKR
Molecular weight 17.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu21-Arg148
Aliases /Synonyms N-WASP, WASL, Neural Wiskott-Aldrich syndrome protein
Reference ARO-P12086
Note For research use only.
Molecular Constructor
Leu21–Arg148
Product name ARO-P12086-50
Uniprot ID O00401
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKR
Molecular weight 17.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu21-Arg148
Aliases /Synonyms N-WASP, WASL, Neural Wiskott-Aldrich syndrome protein
Reference ARO-P12086
Note For research use only.
Molecular Constructor
Leu21–Arg148

Introduction

Recombinant Human WASL Protein, also known as Wiskott-Aldrich syndrome protein-like (WASL), is a protein that plays a crucial role in the regulation of actin cytoskeleton dynamics. This protein is encoded by the WASL gene and is a member of the Wiskott-Aldrich syndrome protein (WASP) family. WASL is involved in a variety of cellular processes, including cell motility, adhesion, and immune response. In this article, we will explore the structure, activity, and applications of Recombinant Human WASL Protein.

Structure of Recombinant Human WASL Protein

Recombinant Human WASL Protein is a 559 amino acid protein with a molecular weight of approximately 62 kDa. It contains multiple domains, including an N-terminal EVH1 domain, a central proline-rich region, and a C-terminal VCA domain. The EVH1 domain is responsible for binding to the proline-rich region of other proteins, while the VCA domain is involved in actin binding and polymerization. The proline-rich region acts as a linker between the EVH1 and VCA domains, and also contains binding sites for other proteins.

Activity of Recombinant Human WASL Protein

Recombinant Human WASL Protein is a key regulator of the actin cytoskeleton, which is essential for cell motility and shape. WASL interacts with multiple proteins, including actin, to promote actin polymerization and the formation of actin filaments. This process is important for cell migration, adhesion, and immune response. In addition, WASL has been shown to play a role in cell signaling pathways, such as the Wnt signaling pathway, which is involved in cell proliferation and differentiation.

Applications of Recombinant Human WASL Protein

1. Research tool in cell biology: Recombinant Human WASL Protein is commonly used as a research tool to study the role of WASL in various cellular processes. It can be used to investigate the effects of WASL on actin dynamics, cell motility, and signaling pathways. Recombinant WASL can also be used to study the interactions between WASL and other proteins.

2. Therapeutic applications: Mutations in the WASL gene have been linked to Wiskott-Aldrich syndrome, a rare genetic disorder characterized by immune deficiency, eczema, and low platelet count. Recombinant Human WASL Protein has been used in pre-clinical studies as a potential treatment for this syndrome. It has also shown promise in the treatment of other diseases, such as cancer, where actin dynamics play a role.

3. Diagnostic tool: Recombinant Human WASL Protein can be used as an antigen in diagnostic tests for Wiskott-Aldrich syndrome. Antibodies against WASL can be used to detect the presence of the protein in patient samples, which can aid in the diagnosis of the disease.

4. Production of recombinant antibodies: The EVH1 domain of WASL has been used to produce recombinant antibodies, known as nanobodies, that specifically bind to the proline-rich region of WASL. These nanobodies can be used as research tools or potential therapeutics for diseases involving WASL.

Conclusion

Recombinant Human WASL Protein is a crucial regulator of actin cytoskeleton dynamics, playing a role in cell motility, adhesion, and immune response. Its structure, activity, and applications make it a valuable tool in cell biology research and a potential therapeutic for various diseases. Further studies on this protein may uncover new insights into its role in cellular processes and lead to the development of novel treatments for diseases associated with WASL dysfunction.

Recombinant Human WASL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human WASL Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products