Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPAT3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53EU6
Molecular weight:
28.01 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Ser207–Ser434
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPAT3 Protein, N-His

Product name ARO-P12084-100
Uniprot ID Q53EU6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser207-Ser434
Aliases /Synonyms 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, AGPAT 10, 1-AGPAT 9, GPAT-3, hGPAT3, Glycerol-3-phosphate acyltransferase 3, Lysophosphatidic acid acyltransferase theta, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, LPAAT-theta, Acyl-CoA:glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, Lung cancer metastasis-associated protein 1, MAG1, MAG-1, GPAT3, AGPAT9
Reference ARO-P12084
Note For research use only.
Molecular Constructor
Ser207–Ser434
Product name ARO-P12084-1MG
Uniprot ID Q53EU6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser207-Ser434
Aliases /Synonyms 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, AGPAT 10, 1-AGPAT 9, GPAT-3, hGPAT3, Glycerol-3-phosphate acyltransferase 3, Lysophosphatidic acid acyltransferase theta, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, LPAAT-theta, Acyl-CoA:glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, Lung cancer metastasis-associated protein 1, MAG1, MAG-1, GPAT3, AGPAT9
Reference ARO-P12084
Note For research use only.
Molecular Constructor
Ser207–Ser434
Product name ARO-P12084-50
Uniprot ID Q53EU6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser207-Ser434
Aliases /Synonyms 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, AGPAT 10, 1-AGPAT 9, GPAT-3, hGPAT3, Glycerol-3-phosphate acyltransferase 3, Lysophosphatidic acid acyltransferase theta, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, LPAAT-theta, Acyl-CoA:glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, Lung cancer metastasis-associated protein 1, MAG1, MAG-1, GPAT3, AGPAT9
Reference ARO-P12084
Note For research use only.
Molecular Constructor
Ser207–Ser434

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene for a specific protein is inserted into a host cell and then expressed to produce large quantities of the desired protein. These proteins have become essential tools in various fields of research, diagnostics, and therapeutics. One such recombinant protein is the human GPAT3 protein, which has gained significant interest due to its role in lipid metabolism and its potential as a therapeutic target for various diseases.

Structure of Recombinant Human GPAT3 Protein

The human GPAT3 protein, also known as glycerol-3-phosphate acyltransferase 3, is an enzyme that plays a crucial role in the biosynthesis of triacylglycerol (TAG), the main storage form of fat in the body. The recombinant human GPAT3 protein is composed of 372 amino acids and has a molecular weight of approximately 41 kDa. It contains a conserved catalytic domain, which is responsible for its enzymatic activity, and a transmembrane domain, which anchors the protein to the endoplasmic reticulum membrane.

Activity of Recombinant Human GPAT3 Protein

The main function of the recombinant human GPAT3 protein is to catalyze the first step in the synthesis of TAG, which involves the transfer of an acyl group from acyl-CoA to glycerol-3-phosphate. This reaction is essential for the production of TAG, which is a vital component of cell membranes and a major source of energy in the body. Additionally, GPAT3 has been shown to play a role in regulating lipid metabolism and insulin sensitivity, making it a potential therapeutic target for metabolic disorders such as obesity and diabetes.

Application of Recombinant Human GPAT3 Protein

The recombinant human GPAT3 protein has a wide range of applications in both research and medicine. In research, it is used as a tool to study the role of GPAT3 in lipid metabolism and to investigate its potential as a therapeutic target. It is also used in drug discovery and development, as compounds that can modulate GPAT3 activity may have therapeutic benefits for metabolic disorders.

In medicine, the recombinant human GPAT3 protein has potential applications in the treatment of metabolic disorders. For instance, studies have shown that inhibiting GPAT3 activity can improve insulin sensitivity and reduce fat accumulation in animal models of obesity and diabetes. Therefore, the recombinant protein may be used in the development of new drugs for these conditions. Additionally, GPAT3 may also have a role in cancer, as it has been found to be overexpressed in certain types of tumors, making it a potential target for cancer therapy.

Conclusion

The recombinant human GPAT3 protein is a versatile tool with important roles in lipid metabolism and potential applications in various fields. Its structure and activity have been extensively studied, and it has shown promising results as a therapeutic target for metabolic disorders and cancer. Further research on this protein may lead to the development of new treatments for these diseases, making it an exciting area of study in the field of recombinant proteins.

Recombinant Human GPAT3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPAT3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products