Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM16 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95361
Molecular weight:
23.26 kDa

Original price was: €341.00.Current price is: €275.00.

100ug 19% OFF + 275 loyalty points
Lys384–Pro564
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM16 Protein, N-His

Product name ARO-P12085-100
Uniprot ID O95361
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Molecular weight 23.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys384-Pro564
Aliases /Synonyms Estrogen-responsive B box protein, Tripartite motif-containing protein 16, TRIM16, EBBP, E3 ubiquitin-protein ligase TRIM16
Reference ARO-P12085
Note For research use only.
Molecular Constructor
Lys384–Pro564
Product name ARO-P12085-1MG
Uniprot ID O95361
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Molecular weight 23.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys384-Pro564
Aliases /Synonyms Estrogen-responsive B box protein, Tripartite motif-containing protein 16, TRIM16, EBBP, E3 ubiquitin-protein ligase TRIM16
Reference ARO-P12085
Note For research use only.
Molecular Constructor
Lys384–Pro564
Product name ARO-P12085-50
Uniprot ID O95361
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Molecular weight 23.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys384-Pro564
Aliases /Synonyms Estrogen-responsive B box protein, Tripartite motif-containing protein 16, TRIM16, EBBP, E3 ubiquitin-protein ligase TRIM16
Reference ARO-P12085
Note For research use only.
Molecular Constructor
Lys384–Pro564

Introduction

Recombinant Human TRIM16 Protein is a highly versatile and important protein in the field of biotechnology. It is a member of the tripartite motif (TRIM) protein family, which plays a crucial role in various cellular processes such as protein degradation, cell signaling, and immune response. In this article, we will discuss the structure, activity, and application of this recombinant protein in detail.

Structure of Recombinant Human TRIM16 Protein

The TRIM16 gene encodes for a protein of 600 amino acids, which consists of three main domains: a RING finger domain, a B-box domain, and a coiled-coil domain. The RING finger domain is responsible for E3 ubiquitin ligase activity, while the B-box domain is involved in protein-protein interactions. The coiled-coil domain is responsible for the formation of homo- and heterodimers, which are crucial for the function of TRIM16 protein.

Recombinant Human TRIM16 Protein is produced through genetic engineering techniques, where the gene encoding for TRIM16 is inserted into a suitable expression vector and then expressed in a host cell. The recombinant protein is then purified using various chromatography techniques to obtain a highly pure and active form of the protein.

Activity of Recombinant Human TRIM16 Protein

TRIM16 protein has been found to have multiple activities, making it a highly versatile protein. One of its main functions is its E3 ubiquitin ligase activity, where it catalyzes the transfer of ubiquitin molecules to target proteins, leading to their degradation. This activity is crucial for maintaining cellular homeostasis and regulating various cellular processes.

In addition to its E3 ligase activity, TRIM16 protein has also been found to have a role in the regulation of cell signaling pathways. It has been shown to interact with various signaling proteins, such as NF-κB and STAT3, and modulate their activity. This makes TRIM16 protein an important player in the immune response and inflammation.

Furthermore, TRIM16 protein has been found to have a tumor-suppressive role. It has been shown to inhibit the proliferation and migration of cancer cells, making it a potential target for cancer therapy.

Application of Recombinant Human TRIM16 Protein

The diverse activities of TRIM16 protein make it a valuable tool for various applications in biotechnology. One of its main applications is in the field of protein degradation. The E3 ubiquitin ligase activity of TRIM16 protein can be utilized to target specific proteins for degradation, making it a useful tool for studying protein function and for drug discovery.

Another potential application of TRIM16 protein is in the development of therapeutics for cancer and inflammatory diseases. Its ability to regulate cell signaling pathways and inhibit tumor growth makes it a promising target for drug development. Recombinant TRIM16 protein can be used in preclinical studies to evaluate its efficacy as a potential therapeutic agent.

Furthermore, TRIM16 protein can also be used as an antigen in diagnostic assays for autoimmune diseases. Its role in the immune response and inflammation makes it a potential biomarker for various autoimmune disorders, and the recombinant protein can be used to develop specific diagnostic tests.

Conclusion

In conclusion, Recombinant Human TRIM16 Protein is a highly versatile and important protein with multiple activities and potential applications in biotechnology. Its structure, activity, and potential uses make it a valuable tool for studying cellular processes, developing therapeutics, and diagnosing diseases. Further research on this protein is required to fully understand its role and potential in various fields.

Recombinant Human TRIM16 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRIM16 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products