Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYLK2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H1R3
Molecular weight:
31.28 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Ala313–Lys562
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYLK2, N-His

Product name ARO-P13113-100
Uniprot ID Q9H1R3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKK
Molecular weight 31.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala313-Lys562
Aliases /Synonyms Myosin light chain kinase 2, skeletal/cardiac muscle, MLCK2, MYLK2
Reference ARO-P13113
Note For research use only.
Molecular Constructor
Ala313–Lys562
Product name ARO-P13113-1MG
Uniprot ID Q9H1R3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKK
Molecular weight 31.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala313-Lys562
Aliases /Synonyms Myosin light chain kinase 2, skeletal/cardiac muscle, MLCK2, MYLK2
Reference ARO-P13113
Note For research use only.
Molecular Constructor
Ala313–Lys562
Product name ARO-P13113-50
Uniprot ID Q9H1R3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKK
Molecular weight 31.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala313-Lys562
Aliases /Synonyms Myosin light chain kinase 2, skeletal/cardiac muscle, MLCK2, MYLK2
Reference ARO-P13113
Note For research use only.
Molecular Constructor
Ala313–Lys562

Introduction

Recombinant Human MYLK2 is a protein that plays a crucial role in regulating muscle contraction. It is a recombinant protein, meaning it is produced through genetic engineering techniques. In this article, we will discuss the structure, activity, and application of Recombinant Human MYLK2.

Structure of Recombinant Human MYLK2

Recombinant Human MYLK2 is a member of the myosin light chain kinase (MLCK) family of proteins. It is encoded by the MYLK2 gene and is composed of 1,080 amino acids. The protein has a molecular weight of approximately 123 kDa.

The structure of Recombinant Human MYLK2 is characterized by several functional domains. These include the N-terminal catalytic domain, the central calmodulin-binding domain, and the C-terminal regulatory domain. The catalytic domain is responsible for the kinase activity of MYLK2, while the calmodulin-binding domain is involved in the regulation of its activity.

Activity of Recombinant Human MYLK2

The primary function of Recombinant Human MYLK2 is to phosphorylate myosin light chains (MLCs), which are essential for muscle contraction. This process is regulated by the binding of calcium ions to the calmodulin-binding domain of MYLK2. When calcium ions are present, they bind to calmodulin, which in turn activates MYLK2. This leads to the phosphorylation of MLCs, resulting in muscle contraction.

In addition to its role in muscle contraction, Recombinant Human MYLK2 has been found to have other activities as well. It has been shown to play a role in cell migration, cell proliferation, and cell survival. These activities are mediated through the regulation of various signaling pathways, including the RhoA/ROCK pathway and the PI3K/Akt pathway.

Application of Recombinant Human MYLK2

Recombinant Human MYLK2 has various applications in both research and therapeutic settings. One of its primary uses is in the study of muscle contraction and its regulation. Recombinant Human MYLK2 can be used to investigate the role of MYLK2 in different types of muscle cells and tissues.

In addition, Recombinant Human MYLK2 has potential therapeutic applications. It has been found to be overexpressed in certain types of cancer, such as breast cancer and lung cancer. This makes it a potential target for cancer treatment. Inhibitors of MYLK2 have been developed and are being studied for their effectiveness in cancer treatment.

Furthermore, Recombinant Human MYLK2 has been shown to play a role in cardiovascular diseases. It has been found to be involved in the regulation of blood vessel contraction, which can impact blood pressure and blood flow. Therefore, targeting MYLK2 may have potential therapeutic benefits for cardiovascular diseases.

Conclusion

In summary, Recombinant Human MYLK2 is a crucial protein involved in regulating muscle contraction. It is composed of several functional domains, including the catalytic domain, the calmodulin-binding domain, and the regulatory domain. Its activity is regulated by calcium ions, and it has been found to have various roles in cell signaling and disease processes. With its diverse applications in research and potential therapeutic benefits, Recombinant Human MYLK2 is a promising protein for further study and development.

Recombinant Human MYLK2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MYLK2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products