Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EYA3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99504
Molecular weight:
32.60 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Glu303–Leu573
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EYA3 Protein, N-His

Product name ARO-P10696-100
Uniprot ID Q99504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGDLVSLHQALELDFL
Molecular weight 32.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu303-Leu573
Aliases /Synonyms Eyes absent homolog 3, EYA3
Reference ARO-P10696
Note For research use only.
Molecular Constructor
Glu303–Leu573
Product name ARO-P10696-1MG
Uniprot ID Q99504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGDLVSLHQALELDFL
Molecular weight 32.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu303-Leu573
Aliases /Synonyms Eyes absent homolog 3, EYA3
Reference ARO-P10696
Note For research use only.
Molecular Constructor
Glu303–Leu573
Product name ARO-P10696-50
Uniprot ID Q99504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGDLVSLHQALELDFL
Molecular weight 32.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu303-Leu573
Aliases /Synonyms Eyes absent homolog 3, EYA3
Reference ARO-P10696
Note For research use only.
Molecular Constructor
Glu303–Leu573

Introduction

Recombinant Human EYA3 Protein is a highly versatile and important protein that plays a crucial role in various biological processes. It is a member of the EYA family of proteins, which are essential for the development and function of many organs and tissues in the human body. In this article, we will explore the structure, activity, and applications of Recombinant Human EYA3 Protein.

Structure of Recombinant Human EYA3 Protein

Recombinant Human EYA3 Protein is a 592 amino acid protein with a molecular weight of approximately 66 kDa. It consists of a conserved N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain contains a highly conserved EYA domain, which is essential for the protein’s catalytic activity. The central domain contains a transactivation domain, which is responsible for the protein’s ability to activate gene expression. The C-terminal domain contains a PST (proline-serine-threonine)-rich region, which is involved in protein-protein interactions.

Activity of Recombinant Human EYA3 Protein

Recombinant Human EYA3 Protein is a multifunctional protein that possesses both phosphatase and transcriptional co-activator activities. The phosphatase activity of EYA3 is responsible for dephosphorylating tyrosine residues on target proteins, thereby regulating their activity. This activity is crucial for many cellular processes, including cell proliferation, differentiation, and apoptosis. The transcriptional co-activator activity of EYA3 is responsible for activating gene expression by interacting with transcription factors and other co-activators. This activity is essential for the proper development and function of various organs and tissues, including the eyes, ears, heart, and kidneys.

Applications of Recombinant Human EYA3 Protein

Recombinant Human EYA3 Protein has a wide range of applications in both basic research and clinical settings. Some of the key applications of this protein are discussed below.

1. Study of Developmental Processes

The EYA family of proteins, including EYA3, are known to play critical roles in the development of various organs and tissues. Recombinant Human EYA3 Protein can be used in studies to understand the molecular mechanisms underlying these developmental processes. This can provide valuable insights into the role of EYA3 in normal development and its potential role in developmental disorders.

2. Cancer Research

Aberrant expression and activity of EYA3 have been linked to various types of cancer, including breast, prostate, and lung cancer. Recombinant Human EYA3 Protein can be used to study the role of this protein in cancer progression and to develop potential therapeutic strategies targeting EYA3.

3. Drug Discovery

The phosphatase activity of EYA3 makes it an attractive target for drug discovery. Recombinant Human EYA3 Protein can be used in high-throughput screening assays to identify small molecules that can modulate its activity. These molecules can then be further developed into potential drug candidates for the treatment of various diseases.

4. Biomarker for Disease Diagnosis

Elevated levels of EYA3 have been observed in several diseases, including cancer and congenital heart defects. Recombinant Human EYA3 Protein can be used in diagnostic tests to measure the levels of this protein in patient samples, providing valuable information for disease diagnosis and prognosis.

5. Therapeutic Agent

Recombinant Human EYA3 Protein has shown promising results in preclinical studies as a potential therapeutic agent for various diseases. It has been shown to have anti-inflammatory and neuroprotective effects and can potentially be used in the treatment of conditions such as Alzheimer’s disease and stroke.

Conclusion

In summary, Recombinant Human EYA3 Protein is a crucial protein with diverse functions in various biological processes. Its structure, activity, and applications make it an essential tool for both

Recombinant Human EYA3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EYA3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products