Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SECISBP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96T21
Molecular weight:
26.71 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Ser638–Leu854
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SECISBP2 Protein, N-His

Product name ARO-P10702-100
Uniprot ID Q96T21
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL
Molecular weight 26.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser638-Leu854
Aliases /Synonyms SECISBP2, SECIS-binding protein 2, SBP2, Selenocysteine insertion sequence-binding protein 2
Reference ARO-P10702
Note For research use only.
Molecular Constructor
Ser638–Leu854
Product name ARO-P10702-1MG
Uniprot ID Q96T21
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL
Molecular weight 26.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser638-Leu854
Aliases /Synonyms SECISBP2, SECIS-binding protein 2, SBP2, Selenocysteine insertion sequence-binding protein 2
Reference ARO-P10702
Note For research use only.
Molecular Constructor
Ser638–Leu854
Product name ARO-P10702-50
Uniprot ID Q96T21
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL
Molecular weight 26.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser638-Leu854
Aliases /Synonyms SECISBP2, SECIS-binding protein 2, SBP2, Selenocysteine insertion sequence-binding protein 2
Reference ARO-P10702
Note For research use only.
Molecular Constructor
Ser638–Leu854

Title: Introduction to Recombinant Human SECISBP2 Protein

Recombinant Human SECISBP2 Protein, also known as SECIS Binding Protein 2, is a protein that plays a crucial role in the synthesis of selenoproteins. Selenoproteins are a group of proteins that contain the essential trace element selenium, which is important for various biological processes such as antioxidant defense, thyroid hormone metabolism, and immune function. The SECISBP2 protein is involved in the incorporation of selenium into selenoproteins, making it an essential component of the cellular machinery.

Structure of Recombinant Human SECISBP2 Protein

The SECISBP2 protein is encoded by the SECISBP2 gene, located on chromosome 1 in humans. The protein consists of 1,048 amino acids and has a molecular weight of approximately 120 kDa. It contains several functional domains, including an RNA-binding domain, a zinc finger domain, and a selenocysteine insertion sequence (SECIS) binding domain. These domains are essential for the protein’s function in recognizing and binding to the SECIS element, a specific RNA sequence found in the 3′ untranslated region of selenoprotein mRNAs.

Activity of Recombinant Human SECISBP2 Protein

The primary function of the SECISBP2 protein is to facilitate the incorporation of selenium into selenoproteins. This process involves the recognition and binding of the SECIS element in the mRNA of selenoproteins, followed by the recruitment of specific components of the cellular machinery, including the selenocysteine transfer RNA (tRNA), to the site of translation. The SECISBP2 protein also plays a role in the regulation of selenoprotein synthesis by modulating the efficiency of selenocysteine incorporation into the growing polypeptide chain.

Application of Recombinant Human SECISBP2 Protein

Recombinant Human SECISBP2 Protein has various applications in both research and therapeutic settings. In research, it is used to study the mechanisms of selenoprotein synthesis and the role of selenium in cellular processes. It is also used to investigate the function of specific selenoproteins, as the SECISBP2 protein is essential for their proper synthesis. In addition, recombinant SECISBP2 protein can be used to screen for compounds that modulate selenoprotein synthesis, making it a valuable tool in drug discovery.

In therapeutic applications, recombinant SECISBP2 protein can be used to treat diseases associated with selenium deficiency. These include Keshan disease, a heart disease prevalent in certain regions of China where selenium intake is low, and Kashin-Beck disease, a type of osteoarthritis found in areas with selenium-poor soil. By providing the necessary SECISBP2 protein, recombinant SECISBP2 protein therapy can enhance the synthesis of selenoproteins and alleviate the symptoms of these diseases.

Conclusion

In summary, Recombinant Human SECISBP2 Protein is a vital component in the synthesis of selenoproteins, which are essential for various biological processes. Its structure, activity, and application make it a valuable tool in both research and therapeutic settings. With the increasing interest in the role of selenium in health and disease, the use of recombinant SECISBP2 protein is likely to expand, providing further insights into the complex mechanisms of selenoprotein synthesis and potential treatments for selenium-related disorders.

Recombinant Human SECISBP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SECISBP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products