Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MED30 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96HR3
Molecular weight:
21.34 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Asn29–Gly105
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MED30 Protein, N-His-SUMO

Product name ARO-P11952-100
Uniprot ID Q96HR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGG
Molecular weight 21.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn29-Gly105
Aliases /Synonyms MED30, THRAP6, Mediator complex subunit 30, Thyroid hormone receptor-associated protein 6, TRAP25, TRAP/Mediator complex component TRAP25, Trap25, Mediator of RNA polymerase II transcription subunit 30, Thyroid hormone receptor-associated protein complex 25 kDa component
Reference ARO-P11952
Note For research use only.
Molecular Constructor
Asn29–Gly105
Product name ARO-P11952-1MG
Uniprot ID Q96HR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGG
Molecular weight 21.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn29-Gly105
Aliases /Synonyms MED30, THRAP6, Mediator complex subunit 30, Thyroid hormone receptor-associated protein 6, TRAP25, TRAP/Mediator complex component TRAP25, Trap25, Mediator of RNA polymerase II transcription subunit 30, Thyroid hormone receptor-associated protein complex 25 kDa component
Reference ARO-P11952
Note For research use only.
Molecular Constructor
Asn29–Gly105
Product name ARO-P11952-50
Uniprot ID Q96HR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGG
Molecular weight 21.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn29-Gly105
Aliases /Synonyms MED30, THRAP6, Mediator complex subunit 30, Thyroid hormone receptor-associated protein 6, TRAP25, TRAP/Mediator complex component TRAP25, Trap25, Mediator of RNA polymerase II transcription subunit 30, Thyroid hormone receptor-associated protein complex 25 kDa component
Reference ARO-P11952
Note For research use only.
Molecular Constructor
Asn29–Gly105

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various research and industrial applications. One such protein is the Recombinant Human MED30 Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will discuss the structure, activity, and application of this protein in detail.

Structure of Recombinant Human MED30 Protein

The MED30 protein is a subunit of the Mediator complex, which plays a crucial role in transcriptional regulation by bridging the communication between transcription factors and RNA polymerase II. The human MED30 gene is located on chromosome 19 and encodes a protein of 197 amino acids. The recombinant form of this protein is produced in E. coli using genetic engineering techniques.

The crystal structure of Recombinant Human MED30 Protein has been determined, revealing its unique three-dimensional conformation. It consists of two alpha-helices and six beta-strands arranged in a beta-barrel fold. This structure is similar to other Mediator subunits and is essential for its function in transcriptional regulation.

Activity of Recombinant Human MED30 Protein

Recombinant Human MED30 Protein is involved in multiple cellular processes, including transcriptional regulation, cell cycle progression, and DNA repair. It interacts with various transcription factors and coactivators, such as p53, E2F1, and TFIIF, to regulate gene expression. It also plays a crucial role in the assembly and stability of the Mediator complex.

Studies have shown that Recombinant Human MED30 Protein is essential for cell viability and proliferation. Knockdown of MED30 expression leads to cell cycle arrest and apoptosis, highlighting its critical role in cell growth and survival. It has also been implicated in tumorigenesis, as its overexpression has been observed in various cancers, including breast, lung, and colon cancer.

Application of Recombinant Human MED30 Protein

The unique structure and diverse functions of Recombinant Human MED30 Protein make it a valuable tool in various research and industrial applications. One of its primary applications is in studying transcriptional regulation. The recombinant protein can be used in in vitro transcription assays to study its interaction with transcription factors and coactivators.

Recombinant Human MED30 Protein has also been used in drug discovery and development. As it plays a crucial role in cell proliferation and survival, it is a potential target for cancer therapy. Inhibitors of MED30 have been developed and tested in preclinical studies, showing promising results in inhibiting tumor growth.

Furthermore, Recombinant Human MED30 Protein has been used in the production of monoclonal antibodies. It can be used as an antigen to generate specific antibodies that can be used in various diagnostic and therapeutic applications.

Conclusion

In summary, Recombinant Human MED30 Protein is a crucial component of the Mediator complex and plays a vital role in transcriptional regulation, cell cycle progression, and DNA repair. Its unique structure and diverse functions make it a valuable tool in various research and industrial applications, including drug discovery, cancer therapy, and antibody production. With ongoing research and advancements in recombinant protein technology, the potential of Recombinant Human MED30 Protein in various fields is continuously expanding.

Recombinant Human MED30 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MED30 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products