Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92785
Molecular weight:
25.12 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Glu290–Ser391
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep

Product name ARO-P11707-100
Uniprot ID Q92785
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Molecular weight 25.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu290-Ser391
Aliases /Synonyms Protein requiem, BAF45D, Zinc finger protein ubi-d4, BRG1-associated factor 45D, REQ, DPF2, UBID4, Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2
Reference ARO-P11707
Note For research use only.
Molecular Constructor
Glu290–Ser391
Product name ARO-P11707-1MG
Uniprot ID Q92785
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Molecular weight 25.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu290-Ser391
Aliases /Synonyms Protein requiem, BAF45D, Zinc finger protein ubi-d4, BRG1-associated factor 45D, REQ, DPF2, UBID4, Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2
Reference ARO-P11707
Note For research use only.
Molecular Constructor
Glu290–Ser391
Product name ARO-P11707-50
Uniprot ID Q92785
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Molecular weight 25.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu290-Ser391
Aliases /Synonyms Protein requiem, BAF45D, Zinc finger protein ubi-d4, BRG1-associated factor 45D, REQ, DPF2, UBID4, Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2
Reference ARO-P11707
Note For research use only.
Molecular Constructor
Glu290–Ser391

Introduction to Recombinant Human DPF2 Protein

Recombinant Human DPF2 Protein, also known as D4, is a highly conserved transcription factor that plays a crucial role in regulating gene expression. It belongs to the DPF (D4, zinc finger) family of proteins and is encoded by the DPF2 gene located on chromosome 8q22.3. This protein is expressed in various tissues, including the brain, heart, and skeletal muscle, and has been found to be involved in a wide range of cellular processes such as cell differentiation, proliferation, and apoptosis.

Structure of Recombinant Human DPF2 Protein

Recombinant Human DPF2 Protein is a 788 amino acid protein with a molecular weight of approximately 88 kDa. It contains a highly conserved N-terminal DPF domain, which is responsible for its DNA-binding activity. This domain consists of two C2H2-type zinc fingers that are essential for recognizing specific DNA sequences and regulating gene expression.

In addition to the DPF domain, Recombinant Human DPF2 Protein also contains a C-terminal transcriptional activation domain, which is responsible for activating target gene expression. This domain is rich in proline, glutamine, and serine residues, which are known to play a role in protein-protein interactions and transcriptional regulation.

Activity of Recombinant Human DPF2 Protein

Recombinant Human DPF2 Protein is a key transcription factor that regulates the expression of multiple genes involved in various biological processes. It exerts its activity by binding to specific DNA sequences and recruiting other transcriptional co-factors to the promoter region of target genes.

One of the main functions of Recombinant Human DPF2 Protein is its role in cell differentiation. It has been found to be essential for the differentiation of neuronal cells, cardiac myocytes, and skeletal muscle cells. This is achieved by regulating the expression of genes involved in cell fate determination and tissue-specific gene expression.

Moreover, Recombinant Human DPF2 Protein is also involved in cell proliferation and apoptosis. It has been shown to regulate the expression of genes involved in cell cycle progression and cell death, thereby influencing cell growth and survival.

Applications of Recombinant Human DPF2 Protein

Due to its crucial role in regulating gene expression, Recombinant Human DPF2 Protein has been widely used in various research fields. One of its main applications is in the study of cell differentiation and development. By manipulating the expression of Recombinant Human DPF2 Protein, researchers can better understand the molecular mechanisms involved in cell fate determination and tissue-specific gene expression.

In addition, Recombinant Human DPF2 Protein has also been studied in the context of diseases such as cancer and neurological disorders. Its dysregulation has been associated with various types of cancer, and targeting this protein could potentially lead to new therapeutic strategies. Furthermore, mutations in the DPF2 gene have been linked to neurodevelopmental disorders, highlighting the importance of this protein in brain development and function.

Furthermore, Recombinant Human DPF2 Protein has also been used in the biotechnology industry. It is commonly used as an antigen in antibody production, as well as for the production of recombinant proteins in various expression systems.

Conclusion

In conclusion, Recombinant Human DPF2 Protein is a crucial transcription factor involved in regulating gene expression. Its structure, activity, and diverse applications make it a valuable tool for studying various biological processes and diseases. Further research on this protein could potentially lead to new insights and therapeutic approaches for a wide range of diseases.

Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human DPF2 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products