Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MCM8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UJA3
Molecular weight:
33.26 kDa

Original price was: €314.00.Current price is: €275.00.

100ug 12% OFF + 275 loyalty points
Ser90–Lys366
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MCM8 Protein, N-His

Product name ARO-P11954-100
Uniprot ID Q9UJA3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSK
Molecular weight 33.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser90-Lys366
Aliases /Synonyms MCM8, C20orf154, Minichromosome maintenance 8, DNA helicase MCM8
Reference ARO-P11954
Note For research use only.
Molecular Constructor
Ser90–Lys366
Product name ARO-P11954-1MG
Uniprot ID Q9UJA3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSK
Molecular weight 33.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser90-Lys366
Aliases /Synonyms MCM8, C20orf154, Minichromosome maintenance 8, DNA helicase MCM8
Reference ARO-P11954
Note For research use only.
Molecular Constructor
Ser90–Lys366
Product name ARO-P11954-50
Uniprot ID Q9UJA3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSK
Molecular weight 33.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser90-Lys366
Aliases /Synonyms MCM8, C20orf154, Minichromosome maintenance 8, DNA helicase MCM8
Reference ARO-P11954
Note For research use only.
Molecular Constructor
Ser90–Lys366

Introduction

Recombinant proteins have become an essential tool in various fields of life sciences, including biotechnology, medicine, and research. One such protein is the Recombinant Human MCM8 Protein, which has gained significant attention due to its unique structure, diverse functions, and potential applications. In this article, we will explore the structure, activity, and application of Recombinant Human MCM8 Protein in detail.

Structure of Recombinant Human MCM8 Protein

The MCM8 (Minichromosome Maintenance Complex Component 8) protein belongs to the MCM family of proteins, which play a crucial role in DNA replication and cell cycle regulation. The human MCM8 gene is located on chromosome 20q11.21 and encodes for a protein of 1,037 amino acids with a molecular weight of approximately 116 kDa. The Recombinant Human MCM8 Protein is produced by recombinant DNA technology, where the gene is cloned and expressed in a suitable host organism, such as E. coli or yeast.

The crystal structure of Recombinant Human MCM8 Protein has been determined, revealing a hexameric complex consisting of six identical subunits. Each subunit contains a conserved ATP-binding domain and a DNA-binding domain, which are essential for the protein’s function. The hexameric structure of MCM8 is similar to other MCM family members and is crucial for its activity in DNA replication and cell cycle control.

Activity of Recombinant Human MCM8 Protein

The primary function of Recombinant Human MCM8 Protein is to act as a DNA helicase, which unwinds the double-stranded DNA during replication. It plays a critical role in the initiation and elongation phases of DNA replication, ensuring the accurate and timely duplication of the genetic material. In addition to its role in DNA replication, MCM8 has also been implicated in DNA repair and recombination processes, further highlighting its importance in maintaining genomic stability.

Recent studies have also shown that MCM8 is involved in regulating the cell cycle and cell proliferation. It has been found to interact with various proteins involved in cell cycle checkpoints, suggesting its role in cell cycle control. Moreover, MCM8 has been linked to the development and progression of certain cancers, making it a potential target for cancer therapy.

Application of Recombinant Human MCM8 Protein

Recombinant Human MCM8 Protein has a wide range of applications in both basic research and clinical settings. Its ability to unwind DNA makes it a valuable tool for studying DNA replication and repair mechanisms. It is also used in the development of novel DNA sequencing techniques and diagnostic tools for detecting genetic mutations and diseases.

In the medical field, Recombinant Human MCM8 Protein has shown promising results in cancer treatment. Studies have demonstrated that inhibiting MCM8 expression can lead to cell death in cancer cells, making it a potential target for cancer therapy. Furthermore, MCM8 has been identified as a biomarker for certain types of cancers, allowing for early detection and personalized treatment.

Conclusion

In summary, Recombinant Human MCM8 Protein is a crucial player in DNA replication, cell cycle regulation, and cancer development. Its unique structure and diverse functions make it a valuable tool for various applications in the field of life sciences. With ongoing research and advancements in recombinant protein technology, the potential of MCM8 in both research and clinical settings is yet to be fully realized.

Recombinant Human MCM8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MCM8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products