Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02778
Molecular weight:
22.27 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Val22–Pro98
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep

Product name ARO-P11711-100
Uniprot ID P02778
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular weight 22.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Pro98
Aliases /Synonyms Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-P11711
Note For research use only.
Molecular Constructor
Val22–Pro98
Product name ARO-P11711-1MG
Uniprot ID P02778
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular weight 22.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Pro98
Aliases /Synonyms Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-P11711
Note For research use only.
Molecular Constructor
Val22–Pro98
Product name ARO-P11711-50
Uniprot ID P02778
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular weight 22.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Pro98
Aliases /Synonyms Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-P11711
Note For research use only.
Molecular Constructor
Val22–Pro98

Introduction

Recombinant Human CXCL10/IP-10 Protein, also known as interferon gamma-induced protein 10 (IP-10), is a chemokine protein that plays a crucial role in the immune system. It is produced by various cell types, including monocytes, endothelial cells, fibroblasts, and keratinocytes, in response to interferon-gamma (IFN-γ) stimulation. This protein is involved in a range of biological processes, including inflammation, immune response, and cell migration, making it a valuable tool in both research and clinical applications.

Structure of Recombinant Human CXCL10/IP-10 Protein

The recombinant form of CXCL10/IP-10 is a 77 amino acid protein with a molecular weight of approximately 8.5 kDa. It is composed of a single chain of amino acids with a conserved N-terminal sequence and a highly variable C-terminal sequence. The protein contains four cysteine residues that form two disulfide bonds, which are essential for maintaining its tertiary structure and biological activity.

The three-dimensional structure of CXCL10/IP-10 consists of a three-stranded β-sheet and an α-helix, which are connected by two loops. The N-terminal region contains the first two β-strands, while the C-terminal region contains the third β-strand and the α-helix. This unique structure allows CXCL10/IP-10 to interact with its receptors and exert its biological functions.

Activity of Recombinant Human CXCL10/IP-10 Protein

CXCL10/IP-10 is a potent chemoattractant for immune cells, particularly T cells, natural killer (NK) cells, and monocytes. It exerts its activity by binding to its receptors, CXCR3 and CXCR3B, which are expressed on the surface of these cells. This binding triggers a signaling cascade that leads to the activation of various immune cell functions, such as cell migration, adhesion, and cytokine production.

In addition to its chemoattractant activity, CXCL10/IP-10 also has anti-angiogenic properties. It inhibits the growth of new blood vessels by suppressing the proliferation and migration of endothelial cells, which is important in controlling inflammation and tumor growth.

Applications of Recombinant Human CXCL10/IP-10 Protein

Recombinant Human CXCL10/IP-10 Protein has various applications in both research and clinical settings. In research, it is used as a tool to study the role of CXCL10/IP-10 in various biological processes, including immune response, inflammation, and angiogenesis. It can also be used to investigate the signaling pathways involved in CXCL10/IP-10-mediated functions.

In clinical applications, CXCL10/IP-10 has been shown to be a potential biomarker for various diseases, such as autoimmune disorders, viral infections, and cancer. Elevated levels of CXCL10/IP-10 have been observed in patients with rheumatoid arthritis, multiple sclerosis, hepatitis, and various types of cancer. This makes CXCL10/IP-10 a promising diagnostic and prognostic marker for these diseases.

Furthermore, recombinant CXCL10/IP-10 has been used in clinical trials as a therapeutic agent for the treatment of various diseases. It has been shown to have anti-tumor activity in preclinical studies, and clinical trials are currently underway to evaluate its efficacy in cancer treatment. In addition, CXCL10/IP-10 has been investigated as a potential therapeutic for autoimmune disorders and viral infections, with promising results.

Conclusion

Recombinant Human CXCL10/IP-10 Protein is a versatile chemokine that plays a crucial role in the immune system. Its unique structure and activity make it a valuable tool in research and a potential biomarker and therapeutic agent in clinical applications. With ongoing research and clinical trials, the full potential

Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products