Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KRT8/CK-8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P05787
Molecular weight:
40.65 kDa

Original price was: €418.00.Current price is: €329.00.

100ug 21% OFF + 329 loyalty points
Asp81–Ser410
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KRT8/CK-8 Protein, N-His

Product name ARO-P10901-100
Uniprot ID P05787
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Molecular weight 40.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp81-Ser410
Aliases /Synonyms Type-II keratin Kb8, CYK8, Keratin-8, KRT8, Keratin, type II cytoskeletal 8, Cytokeratin-8, CK-8, K8
Reference ARO-P10901
Note For research use only.
Molecular Constructor
Asp81–Ser410
Product name ARO-P10901-1MG
Uniprot ID P05787
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Molecular weight 40.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp81-Ser410
Aliases /Synonyms Type-II keratin Kb8, CYK8, Keratin-8, KRT8, Keratin, type II cytoskeletal 8, Cytokeratin-8, CK-8, K8
Reference ARO-P10901
Note For research use only.
Molecular Constructor
Asp81–Ser410
Product name ARO-P10901-50
Uniprot ID P05787
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Molecular weight 40.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp81-Ser410
Aliases /Synonyms Type-II keratin Kb8, CYK8, Keratin-8, KRT8, Keratin, type II cytoskeletal 8, Cytokeratin-8, CK-8, K8
Reference ARO-P10901
Note For research use only.
Molecular Constructor
Asp81–Ser410

Introduction to Recombinant Human KRT8/CK-8 Protein

Recombinant Human KRT8/CK-8 Protein, also known as Keratin 8 or Cytokeratin 8, is a type II intermediate filament protein that is encoded by the KRT8 gene. It is a member of the keratin family and is primarily expressed in simple epithelial cells, such as those found in the liver, pancreas, and intestine. This protein plays a crucial role in maintaining the structural integrity and mechanical strength of these cells. Recombinant Human KRT8/CK-8 Protein is produced through recombinant DNA technology and has a wide range of applications in both research and medical fields.

Structure of Recombinant Human KRT8/CK-8 Protein

Recombinant Human KRT8/CK-8 Protein is a 54-kDa protein that consists of 483 amino acids. It has a highly conserved central α-helical rod domain, which is responsible for its filament-forming ability. This domain is flanked by non-helical head and tail domains that are essential for its interaction with other proteins and cellular structures. The protein also contains multiple phosphorylation sites that regulate its function and stability.

Activity of Recombinant Human KRT8/CK-8 Protein

The primary function of Recombinant Human KRT8/CK-8 Protein is to provide structural support to simple epithelial cells. It forms intermediate filaments that are essential for maintaining the mechanical strength and integrity of these cells. It also plays a role in cell signaling, cell motility, and cell growth. Additionally, Recombinant Human KRT8/CK-8 Protein has been shown to interact with other cytoskeletal proteins, such as actin and vimentin, to form a network of filaments that provide support and stability to the cell.

Furthermore, Recombinant Human KRT8/CK-8 Protein has been found to be involved in various cellular processes, such as apoptosis, autophagy, and stress response. It has been shown to regulate the activity of certain enzymes and transcription factors, thereby affecting gene expression and cell function. Studies have also demonstrated that alterations in the expression or activity of this protein can lead to various diseases, including liver and pancreatic disorders.

Application of Recombinant Human KRT8/CK-8 Protein

Recombinant Human KRT8/CK-8 Protein has a wide range of applications in both research and medical fields. In research, it is used as an antigen in studies related to cell biology, cytoskeleton dynamics, and disease mechanisms. It is also used as a marker for identifying and characterizing different types of epithelial cells. Additionally, Recombinant Human KRT8/CK-8 Protein is used in drug screening and toxicity studies, as changes in its expression or activity can indicate cell damage or dysfunction.

In the medical field, Recombinant Human KRT8/CK-8 Protein is used as a diagnostic and prognostic marker for various diseases. Its levels have been found to be altered in conditions such as liver cirrhosis, pancreatic cancer, and inflammatory bowel disease. It is also used as a biomarker for predicting treatment response and disease progression in these conditions. Furthermore, Recombinant Human KRT8/CK-8 Protein has potential therapeutic applications, as it has been shown to inhibit tumor growth and enhance drug sensitivity in cancer cells.

Conclusion

In conclusion, Recombinant Human KRT8/CK-8 Protein is a crucial protein that plays a vital role in maintaining the structural integrity and function of simple epithelial cells. Its recombinant form has been widely used in research and medical fields due to its various applications and potential therapeutic benefits. Further studies on this protein may provide insights into its role in disease mechanisms and lead to the development of novel treatments for various disorders.

Recombinant Human KRT8/CK-8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KRT8/CK-8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products