Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14011
Molecular weight:
22.66 kDa

Original price was: €327.00.Current price is: €275.00.

100ug 16% OFF + 275 loyalty points
Ala2–Gly83
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep

Product name ARO-P10750-100
Uniprot ID Q14011
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAG
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly83
Aliases /Synonyms CIRBP, A18 hnRNP, CIRP, Glycine-rich RNA-binding protein CIRP, A18HNRNP, Cold-inducible RNA-binding protein
Reference ARO-P10750
Note For research use only.
Molecular Constructor
Ala2–Gly83
Product name ARO-P10750-1MG
Uniprot ID Q14011
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAG
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly83
Aliases /Synonyms CIRBP, A18 hnRNP, CIRP, Glycine-rich RNA-binding protein CIRP, A18HNRNP, Cold-inducible RNA-binding protein
Reference ARO-P10750
Note For research use only.
Molecular Constructor
Ala2–Gly83
Product name ARO-P10750-50
Uniprot ID Q14011
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAG
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly83
Aliases /Synonyms CIRBP, A18 hnRNP, CIRP, Glycine-rich RNA-binding protein CIRP, A18HNRNP, Cold-inducible RNA-binding protein
Reference ARO-P10750
Note For research use only.
Molecular Constructor
Ala2–Gly83

Introduction

Recombinant Human CIRBP Protein, also known as Cold-Inducible RNA-Binding Protein, is a highly conserved protein that plays a crucial role in cellular stress response. It is encoded by the CIRBP gene and is found in various species, including humans. In this article, we will discuss the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human CIRBP Protein

Recombinant Human CIRBP Protein is a 20 kDa protein composed of 172 amino acids. It contains two RNA-binding domains, a glycine-rich domain, and a C-terminal domain. The RNA-binding domains are responsible for binding to specific RNA sequences, while the glycine-rich domain is involved in protein-protein interactions. The C-terminal domain is essential for the protein’s stability and function.

The protein has a conserved secondary structure, with beta-sheets and alpha-helices. It also contains disulfide bonds that contribute to its stability. The recombinant protein is produced through genetic engineering techniques, where the CIRBP gene is inserted into a suitable expression vector and expressed in a host organism, such as bacteria or yeast.

Activity of Recombinant Human CIRBP Protein

Recombinant Human CIRBP Protein is a stress-induced protein that is upregulated in response to various stressors, such as low temperature, hypoxia, and UV radiation. It acts as an RNA chaperone, binding to specific RNA sequences and regulating their stability and translation. It also interacts with other proteins involved in stress response pathways, such as heat shock proteins and DNA damage repair proteins.

One of the key functions of CIRBP is its role in regulating cellular metabolism. It has been shown to interact with enzymes involved in glycolysis and oxidative phosphorylation, thereby regulating energy production in response to stress. Additionally, CIRBP has been found to play a role in cell proliferation, differentiation, and apoptosis, making it a crucial protein in various cellular processes.

Applications of Recombinant Human CIRBP Protein

The unique structure and activity of Recombinant Human CIRBP Protein make it a valuable tool in various research and industrial applications. Some of the key applications of this protein are:

1. Study of stress response pathways

Recombinant Human CIRBP Protein is an essential component of stress response pathways, making it an ideal tool for studying these pathways. Its overexpression or knockdown in cells can provide valuable insights into the role of CIRBP in stress response and its crosstalk with other proteins.

2. Biomarker for stress-related diseases

As CIRBP is upregulated in response to stress, it has been proposed as a potential biomarker for various stress-related diseases, such as cancer, cardiovascular diseases, and neurodegenerative disorders. Recombinant Human CIRBP Protein can be used in diagnostic tests to measure its levels in patient samples and aid in disease diagnosis and prognosis.

3. Drug target for stress-related diseases

Given its crucial role in stress response and its involvement in various cellular processes, CIRBP has emerged as a potential drug target for stress-related diseases. Recombinant Human CIRBP Protein can be used in drug screening assays to identify compounds that can modulate its activity and potentially treat stress-related disorders.

4. Industrial applications

Recombinant Human CIRBP Protein has also found applications in the industrial sector. It is used in the production of stable cell lines for the production of therapeutic proteins, as well as in the development of stress-tolerant crops for agriculture.

Conclusion

In summary, Recombinant Human CIRBP Protein is a highly conserved protein with a unique structure

Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products