Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DBP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q10586
Molecular weight:
17.90 kDa

Original price was: €288.00.Current price is: €230.00.

50ug 20% OFF + 230 loyalty points
Pro193–Leu325
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DBP Protein, N-His

Product name ARO-P10756-100
Uniprot ID Q10586
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Molecular weight 17.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro193-Leu325
Aliases /Synonyms Albumin D box-binding protein, TaxREB302, Tax-responsive enhancer element-binding protein 302, D site-binding protein, DBP, Albumin D-element-binding protein
Reference ARO-P10756
Note For research use only.
Molecular Constructor
Pro193–Leu325
Product name ARO-P10756-1MG
Uniprot ID Q10586
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Molecular weight 17.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro193-Leu325
Aliases /Synonyms Albumin D box-binding protein, TaxREB302, Tax-responsive enhancer element-binding protein 302, D site-binding protein, DBP, Albumin D-element-binding protein
Reference ARO-P10756
Note For research use only.
Molecular Constructor
Pro193–Leu325
Product name ARO-P10756-50
Uniprot ID Q10586
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Molecular weight 17.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro193-Leu325
Aliases /Synonyms Albumin D box-binding protein, TaxREB302, Tax-responsive enhancer element-binding protein 302, D site-binding protein, DBP, Albumin D-element-binding protein
Reference ARO-P10756
Note For research use only.
Molecular Constructor
Pro193–Leu325

Introduction

Recombinant Human DBP Protein, also known as Vitamin D binding protein, is a multifunctional protein that plays a crucial role in the transport and metabolism of vitamin D in the body. This protein is encoded by the GC gene and is found in the blood and extracellular fluids.

Structure of Recombinant Human DBP Protein

The recombinant form of human DBP protein is a glycoprotein with a molecular weight of approximately 58 kDa. It is composed of 458 amino acids and has a three-dimensional structure similar to that of other members of the albumin superfamily. The protein contains three domains: a N-terminal domain, a central domain, and a C-terminal domain.

The N-terminal domain is responsible for binding to vitamin D and its metabolites, while the central domain is involved in binding to fatty acids and other ligands. The C-terminal domain is responsible for the transport of DBP across the cell membrane.

Activity of Recombinant Human DBP Protein

The main function of recombinant human DBP protein is to bind to and transport vitamin D and its metabolites in the blood. It has a high affinity for 25-hydroxyvitamin D, the major circulating form of vitamin D, and also binds to other forms such as 1,25-dihydroxyvitamin D and 24,25-dihydroxyvitamin D.

In addition to its role in vitamin D transport, DBP has been shown to have other activities such as antioxidant and anti-inflammatory properties. It also plays a role in regulating the immune system and has been implicated in various diseases such as cancer, diabetes, and autoimmune disorders.

Application of Recombinant Human DBP Protein

The production of recombinant human DBP protein has numerous applications in the field of medicine and research. One of the main applications is in the diagnosis and monitoring of vitamin D deficiency. Measurement of DBP levels in the blood can provide valuable information about an individual’s vitamin D status.

Another important application is in the development of therapeutic drugs. Recombinant DBP protein has been used in studies to evaluate its potential as a treatment for various diseases such as diabetes, multiple sclerosis, and inflammatory bowel disease. It has also been investigated as a potential biomarker for predicting the risk of developing certain diseases.

Furthermore, recombinant human DBP protein has been used in research to study the role of vitamin D in various physiological processes and diseases. Its ability to bind to different forms of vitamin D makes it a valuable tool for investigating the mechanisms of action of this important vitamin.

Conclusion

In summary, recombinant human DBP protein is a multifunctional protein with a crucial role in the transport and metabolism of vitamin D. Its structure, activity, and various applications make it a valuable tool in the fields of medicine and research. Further studies on this protein may provide insights into its potential therapeutic uses and shed light on the role of vitamin D in various diseases.

Recombinant Human DBP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DBP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products