Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CRHR2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13324
Molecular weight:
22.46 kDa

Original price was: €319.00.Current price is: €275.00.

100ug 14% OFF + 275 loyalty points
Glu20–Lys108
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CRHR2 Protein, N-His-SUMO

Product name ARO-P10753-100
Uniprot ID Q13324
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRK
Molecular weight 22.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu20-Lys108
Aliases /Synonyms CRH-R-2, CRH2R, Corticotropin-releasing factor receptor 2, CRH-R2, CRHR2, CRF-R2, CRFR-2, CRF-R-2, CRF2R, Corticotropin-releasing hormone receptor 2
Reference ARO-P10753
Note For research use only.
Molecular Constructor
Glu20–Lys108
Product name ARO-P10753-1MG
Uniprot ID Q13324
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRK
Molecular weight 22.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu20-Lys108
Aliases /Synonyms CRH-R-2, CRH2R, Corticotropin-releasing factor receptor 2, CRH-R2, CRHR2, CRF-R2, CRFR-2, CRF-R-2, CRF2R, Corticotropin-releasing hormone receptor 2
Reference ARO-P10753
Note For research use only.
Molecular Constructor
Glu20–Lys108
Product name ARO-P10753-50
Uniprot ID Q13324
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRK
Molecular weight 22.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu20-Lys108
Aliases /Synonyms CRH-R-2, CRH2R, Corticotropin-releasing factor receptor 2, CRH-R2, CRHR2, CRF-R2, CRFR-2, CRF-R-2, CRF2R, Corticotropin-releasing hormone receptor 2
Reference ARO-P10753
Note For research use only.
Molecular Constructor
Glu20–Lys108

Introduction

Recombinant Human CRHR2 Protein, also known as Corticotropin-Releasing Hormone Receptor 2, is a protein that plays a crucial role in the stress response and regulation of the hypothalamic-pituitary-adrenal axis. This protein is encoded by the CRHR2 gene and is a member of the G-protein coupled receptor family. In this article, we will discuss the structure, activity, and applications of Recombinant Human CRHR2 Protein.

Structure of Recombinant Human CRHR2 Protein

The human CRHR2 gene is located on chromosome 7 and consists of 14 exons. The protein is composed of 415 amino acids and has a molecular weight of approximately 47 kDa. It has a seven-transmembrane domain structure, which is characteristic of G-protein coupled receptors. The extracellular domain of CRHR2 contains two cysteine-rich regions, which are important for ligand binding. The intracellular domain contains several phosphorylation sites, which are involved in the regulation of receptor activity.

Activity of Recombinant Human CRHR2 Protein

The primary function of CRHR2 is to bind with its ligand, corticotropin-releasing hormone (CRH), and activate the signaling pathways that lead to the release of cortisol from the adrenal glands. This hormone is responsible for the body’s response to stress and plays a crucial role in maintaining homeostasis. CRHR2 is also expressed in various brain regions, including the hippocampus, amygdala, and prefrontal cortex, where it is involved in the regulation of mood and anxiety.

Studies have shown that Recombinant Human CRHR2 Protein has a high affinity for CRH and can activate both Gs and Gq signaling pathways. The activation of Gs leads to the production of cyclic adenosine monophosphate (cAMP), which is involved in the activation of protein kinase A (PKA) and other downstream signaling molecules. On the other hand, the activation of Gq leads to the production of inositol trisphosphate (IP3) and diacylglycerol (DAG), which are involved in the activation of protein kinase C (PKC) and other downstream signaling molecules.

Applications of Recombinant Human CRHR2 Protein

Recombinant Human CRHR2 Protein has various applications in both research and therapeutic settings. One of the main applications of this protein is in the study of stress and its effects on the body. Researchers can use this protein to investigate the role of CRHR2 in the stress response and its involvement in various diseases, such as anxiety and depression.

In addition to its research applications, Recombinant Human CRHR2 Protein has potential therapeutic uses. As CRHR2 is involved in the regulation of mood and anxiety, targeting this protein could be a potential treatment for anxiety disorders. Several studies have shown that CRHR2 antagonists can reduce anxiety-like behaviors in animal models, making them a promising target for drug development.

Conclusion

In summary, Recombinant Human CRHR2 Protein is a crucial protein involved in the stress response and regulation of the hypothalamic-pituitary-adrenal axis. It has a unique structure with a seven-transmembrane domain and plays a role in both Gs and Gq signaling pathways. This protein has various applications in research and has potential therapeutic uses in the treatment of anxiety disorders. Further studies on CRHR2 and its ligand, CRH, could lead to a better understanding of the stress response and the development of new treatments for stress-related disorders.

SDS-PAGE for Recombinant Human CRHR2 Protein, N-His-SUMO

SDS-PAGE for Recombinant Human CRHR2 Protein, N-His-SUMO

Recombinant Human CRHR2 Protein, N-His-SUMO, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human CRHR2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CRHR2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products