Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DOCK5 Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H7D0
Molecular weight:
41.79 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Arg1627–Ala1761
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DOCK5 Protein, N-GST

Product name ARO-P10386-100
Uniprot ID Q9H7D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKA
Molecular weight 41.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1627-Ala1761
Aliases /Synonyms Dedicator of cytokinesis protein 5, DOCK5
Reference ARO-P10386
Note For research use only.
Molecular Constructor
Arg1627–Ala1761
Product name ARO-P10386-1MG
Uniprot ID Q9H7D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKA
Molecular weight 41.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1627-Ala1761
Aliases /Synonyms Dedicator of cytokinesis protein 5, DOCK5
Reference ARO-P10386
Note For research use only.
Molecular Constructor
Arg1627–Ala1761
Product name ARO-P10386-50
Uniprot ID Q9H7D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKA
Molecular weight 41.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1627-Ala1761
Aliases /Synonyms Dedicator of cytokinesis protein 5, DOCK5
Reference ARO-P10386
Note For research use only.
Molecular Constructor
Arg1627–Ala1761

Introduction to Recombinant Human DOCK5 Protein

Recombinant Human DOCK5 Protein is a type of protein that is produced through genetic engineering techniques. It is a highly purified form of the human DOCK5 protein, which is a member of the DOCK family of proteins that are involved in cell signaling and cellular processes such as cell migration and adhesion. This protein has been extensively studied and has been found to play a crucial role in various physiological and pathological processes. In this article, we will provide a detailed description of the structure, activity, and applications of Recombinant Human DOCK5 Protein.

Structure of Recombinant Human DOCK5 Protein

The DOCK5 gene is located on chromosome 8 and encodes for a protein of 2130 amino acids. The recombinant form of this protein is produced by inserting the gene into a suitable expression system, such as bacteria, yeast, or mammalian cells, and allowing it to be expressed and purified. The resulting protein is a single polypeptide chain with a molecular weight of approximately 240 kDa.

The structure of Recombinant Human DOCK5 Protein is divided into several functional domains, each with a specific role in its activity. The N-terminal region contains a DHR-1 domain, which is responsible for binding to phospholipids and regulating the protein’s activity. The central region contains two DHR-2 domains, which are involved in binding to small GTPases and mediating the protein’s interaction with other cellular proteins. The C-terminal region contains a SH3 domain, which is responsible for binding to proline-rich motifs in other proteins and regulating their activity.

Activity of Recombinant Human DOCK5 Protein

The primary function of Recombinant Human DOCK5 Protein is to act as a guanine nucleotide exchange factor (GEF) for small GTPases, specifically Rac1 and Cdc42. This means that it facilitates the exchange of GDP for GTP on these GTPases, thereby activating them and promoting downstream signaling events. This activity is crucial for the regulation of cell migration, adhesion, and cytoskeletal dynamics.

In addition to its GEF activity, Recombinant Human DOCK5 Protein has also been found to interact with other cellular proteins, including cytoskeletal proteins, kinases, and phosphatases. These interactions suggest that this protein may have additional roles in regulating cellular processes, such as cell cycle progression and cell survival.

Applications of Recombinant Human DOCK5 Protein

The unique structure and activity of Recombinant Human DOCK5 Protein make it a valuable tool for various research applications. One of the most common uses of this protein is in in vitro studies to understand its role in cell signaling and cellular processes. Its ability to activate small GTPases makes it a useful tool for studying the downstream effects of these GTPases in different cell types and under different conditions.

Recombinant Human DOCK5 Protein has also been used in in vivo studies, where it has been shown to play a role in various physiological and pathological processes. For example, DOCK5 has been found to be overexpressed in certain types of cancer, and its inhibition has been shown to suppress tumor growth and metastasis. This suggests that this protein may be a potential therapeutic target for cancer treatment.

Furthermore, Recombinant Human DOCK5 Protein has been used in drug discovery and development, as its activity can be modulated by small molecules. This makes it a potential target for developing novel therapies for various diseases.

Conclusion

In summary, Recombinant Human DOCK5 Protein is a highly purified form of the human DOCK5 protein that is produced through genetic engineering techniques. Its unique structure and activity make it a valuable tool for studying cell signaling and cellular processes. Its potential role in various physiological and pathological processes makes it a promising target for drug development and

Recombinant Human DOCK5 Protein, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human DOCK5 Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products