Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P19438
Molecular weight:
22.66 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Pro356–Leu441
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO

Product name ARO-P10391-100
Uniprot ID P19438
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEAL
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro356-Leu441
Aliases /Synonyms TNFR-I, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor superfamily member 1A, TBPI, p60, CD120a, TNFRSF1A, Tumor necrosis factor receptor type I, p55, TNF-RI, TNFAR, TNFR1, TNF-R1
Reference ARO-P10391
Note For research use only.
Molecular Constructor
Pro356–Leu441
Product name ARO-P10391-1MG
Uniprot ID P19438
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEAL
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro356-Leu441
Aliases /Synonyms TNFR-I, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor superfamily member 1A, TBPI, p60, CD120a, TNFRSF1A, Tumor necrosis factor receptor type I, p55, TNF-RI, TNFAR, TNFR1, TNF-R1
Reference ARO-P10391
Note For research use only.
Molecular Constructor
Pro356–Leu441
Product name ARO-P10391-50
Uniprot ID P19438
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEAL
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro356-Leu441
Aliases /Synonyms TNFR-I, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor superfamily member 1A, TBPI, p60, CD120a, TNFRSF1A, Tumor necrosis factor receptor type I, p55, TNF-RI, TNFAR, TNFR1, TNF-R1
Reference ARO-P10391
Note For research use only.
Molecular Constructor
Pro356–Leu441

Title: Introduction to Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, also known as Tumor Necrosis Factor Receptor 1 (TNFR1), is a cell surface receptor that plays a crucial role in the immune response and inflammation. This protein is produced through recombinant technology, making it a valuable tool for research and therapeutic applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein.

Structure of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein is a type I transmembrane glycoprotein that belongs to the TNF receptor superfamily. It is composed of 455 amino acids and has a molecular weight of approximately 55 kDa. The extracellular domain of this protein contains four cysteine-rich domains, which are important for ligand binding. The intracellular domain contains a death domain, which is essential for signaling and activation of downstream pathways.

Activity of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein is the primary receptor for tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine that is involved in various physiological and pathological processes. Upon binding to TNF-α, CD120a/TNFRSF1A/TNFR1 Protein forms a trimeric complex, which leads to the activation of downstream signaling pathways. This results in the production of cytokines, chemokines, and other inflammatory mediators, leading to the recruitment of immune cells and the initiation of an immune response.

Applications of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein has a wide range of applications in research and medicine. Here are some of the main applications of this protein:

1. Research: Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein is commonly used in research to study the role of TNF-α in various diseases and conditions. It can be used to investigate the signaling pathways activated by TNF-α and the effects of blocking or activating these pathways.

2. Drug development: TNF-α is a major therapeutic target for the treatment of inflammatory diseases such as rheumatoid arthritis, Crohn’s disease, and psoriasis. Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein can be used to screen potential drugs that can block the interaction between TNF-α and its receptor, thereby reducing inflammation.

3. Diagnosis: The levels of TNF-α and its receptor have been found to be elevated in several diseases, making them potential biomarkers for diagnosis and disease monitoring. Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein can be used in diagnostic assays to measure the levels of TNF-α and its receptor in patient samples.

4. Immunotherapy: Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein has been investigated as a potential immunotherapeutic agent for the treatment of cancer. By targeting TNF-α, it can modulate the immune response and enhance the anti-tumor activity of immune cells.

5. Vaccine development: TNF-α has been shown to play a role in the immune response to viral infections. Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein can be used in vaccine development to enhance the immune response against viral antigens.

Conclusion

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein is a vital tool for studying the role of TNF-α in various diseases and conditions. Its structure and activity make

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products