Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08833
Molecular weight:
28.82kDa

Original price was: €290.00.Current price is: €259.00.

50ug 11% OFF + 259 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

Product name Recombinant Human Insulin-like Growth Factor proteins-binding protein 1 (IGFBP1)
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Molecular weight 28.82kDa
Protein delivered with Tag? Yes
Purity estimated 60%-70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein
Reference PX-P4057
Note For research use only
Molecular Constructor
Full-length Yes
Product name Recombinant Human Insulin-like Growth Factor proteins-binding protein 1 (IGFBP1)
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Molecular weight 28.82kDa
Protein delivered with Tag? Yes
Purity estimated 60%-70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein
Reference PX-P4057
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P4057-1MG
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Molecular weight 28.82kDa
Protein delivered with Tag? Yes
Purity estimated 60%-70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein
Reference PX-P4057
Note For research use only
Molecular Constructor
Full-length Yes

Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)

There are no reviews yet.

Be the first to review “Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products