Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Parathyroid hormone(PTH)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01270
Molecular weight:
13.83kDa

€420.00

100ug + 420 loyalty points
Met1–Gln115 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Parathyroid hormone(PTH)

Parathyroid hormone(PTH)

Product name Parathyroid hormone(PTH)
Uniprot ID P01270
Uniprot link https://www.uniprot.org/uniprot/P01270
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Molecular weight 13.83kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gln115
Protein Accession P01270
Spec:Entrez GeneID 5741
Spec:NCBI Gene Aliases FIH1; PTH1
Spec:SwissProtID Q4VB48
NCBI Reference P01270
Aliases /Synonyms Parathormone;Parathyrin
Reference PX-P4568
Note For research use only
Molecular Constructor
Met1–Gln115 His
Product name Parathyroid hormone(PTH)
Uniprot ID P01270
Uniprot link https://www.uniprot.org/uniprot/P01270
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Molecular weight 13.83kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gln115
Protein Accession P01270
Spec:Entrez GeneID 5741
Spec:NCBI Gene Aliases FIH1; PTH1
Spec:SwissProtID Q4VB48
NCBI Reference P01270
Aliases /Synonyms Parathormone;Parathyrin
Reference PX-P4568
Note For research use only
Molecular Constructor
Met1–Gln115 His

There are no reviews yet.

Be the first to review “Parathyroid hormone(PTH)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products