Name: Fibrinogen-like protein 1(FGL1)
SKU: PX-P4638-100
Availability: InStock

Product name	Fibrinogen-like protein 1(FGL1)
Uniprot ID	Q08830
Uniprot link	https://www.uniprot.org/uniprot/Q08830
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight	35.32kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1-IIe312
Protein Accession	Q08830
Spec:Entrez GeneID	2267
Spec:NCBI Gene Aliases	HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID	Q4PJH9
NCBI Reference	Q08830
Aliases /Synonyms	HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference	PX-P4638
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Fibrinogen-like protein 1(FGL1)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product