Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fibrinogen-like protein 1(FGL1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q08830
Molecular weight:
35.32kDa

Original price was: €150.00.Current price is: €126.00.

10ug 16% OFF + 126 loyalty points
Met1–IIe312 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Fibrinogen-like protein 1(FGL1)

Product name Fibrinogen-like protein 1(FGL1)
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His
Product name Fibrinogen-like protein 1(FGL1)
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His
Product name Fibrinogen-like protein 1(FGL1)
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His
Product name PX-P4638-1MG
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His

There are no reviews yet.

Be the first to review “Fibrinogen-like protein 1(FGL1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products