Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant human VEGF Receptor 1 protein-FLT 1

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P17948
Molecular weight:
37.7kDa

420.00

100ug + 420 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant human VEGF Receptor 1 protein-FLT 1

Product name Recombinant human VEGF Receptor 1 protein-FLT 1
Uniprot ID P17948
Uniprot link http://www.uniprot.org/uniprot/P17948
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIGSHHHHHH
Molecular weight 37.7kDa
Protein delivered with Tag? Yes
Purity estimated 60%-70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms EC 2.7.10.1, FLT, FLT 1, Flt-1, FLT1, Fms like tyrosine kinase 1, Fms related tyrosine kinase 1, Fms related tyrosine kinase 1 (vascular endothelial Growth Factor proteins/vascular permeability factor receptor), Fms related tyrosine kinase 1 vascular endothelial Growth Factor proteins/vascular permeability factor receptor, Fms-like tyrosine kinase 1, FRT, Soluble VEGF receptor 1 14, Soluble VEGFR1 variant 2, Soluble VEGFR1 variant 21, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular endothelial Growth Factor proteins receptor 1, Vascular endothelial Growth Factor proteins vascular permeability factor receptor, Vascular permeability factor receptor, Vascular permeability factor receptor 1, VEGFR 1, VEGFR-1, VEGFR1
Reference PX-P4058
Note For research use only
Molecular Constructor
Partial Yes
Product name Recombinant human VEGF Receptor 1 protein-FLT 1
Uniprot ID P17948
Uniprot link http://www.uniprot.org/uniprot/P17948
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIGSHHHHHH
Molecular weight 37.7kDa
Protein delivered with Tag? Yes
Purity estimated 60%-70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms EC 2.7.10.1, FLT, FLT 1, Flt-1, FLT1, Fms like tyrosine kinase 1, Fms related tyrosine kinase 1, Fms related tyrosine kinase 1 (vascular endothelial Growth Factor proteins/vascular permeability factor receptor), Fms related tyrosine kinase 1 vascular endothelial Growth Factor proteins/vascular permeability factor receptor, Fms-like tyrosine kinase 1, FRT, Soluble VEGF receptor 1 14, Soluble VEGFR1 variant 2, Soluble VEGFR1 variant 21, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular endothelial Growth Factor proteins receptor 1, Vascular endothelial Growth Factor proteins vascular permeability factor receptor, Vascular permeability factor receptor, Vascular permeability factor receptor 1, VEGFR 1, VEGFR-1, VEGFR1
Reference PX-P4058
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Recombinant human VEGF Receptor 1 protein-FLT 1”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products