Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

T-cell surface glycoprotein CD8 beta chain(CD8B)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P10966

210.00

50ug + 210 loyalty points
Met1–Pro170 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

T-cell surface glycoprotein CD8 beta chain(CD8B)

Product name T-cell surface glycoprotein CD8 beta chain(CD8B)
Uniprot ID P10966
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Pro170
Aliases /Synonyms CD8b,CD8B1
Reference PX-P4640
Note For research use only
Molecular Constructor
Met1–Pro170 His
Product name T-cell surface glycoprotein CD8 beta chain(CD8B)
Uniprot ID P10966
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Pro170
Aliases /Synonyms CD8b,CD8B1
Reference PX-P4640
Note For research use only
Molecular Constructor
Met1–Pro170 His

T-cell surface glycoprotein CD8 beta chain(CD8B)

There are no reviews yet.

Be the first to review “T-cell surface glycoprotein CD8 beta chain(CD8B)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products