Brand: ProteoGenix

Recombinant Human HAMP Protein, N-His

ARO-P15066-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: P81172
Molecular weight:: 9.25 kDa

Original price was: €292.00.Current price is: €228.00.

50ug 22% OFF + 228 loyalty points

His Ser25–Thr84

Size Size

50ug Original price was: €292.00.Current price is: €228.00.
100ug Original price was: €403.00.Current price is: €325.00.
1MG Original price was: €1,150.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Human HAMP Protein, N-His

Product name	ARO-P15066-100
Uniprot ID	P81172
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Molecular weight	9.25 kDa
Protein delivered with Tag?	N-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser25-Thr84
Aliases /Synonyms	Putative liver tumor regressor, HEPC, LEAP-1, Liver-expressed antimicrobial peptide 1, PLTR, Hepcidin, LEAP1, Hepc25, Hepc20, HAMP
Reference	ARO-P15066
Note	For research use only.
Molecular Constructor	His Ser25–Thr84

Product name	ARO-P15066-1MG
Uniprot ID	P81172
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Molecular weight	9.25 kDa
Protein delivered with Tag?	N-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser25-Thr84
Aliases /Synonyms	Putative liver tumor regressor, HEPC, LEAP-1, Liver-expressed antimicrobial peptide 1, PLTR, Hepcidin, LEAP1, Hepc25, Hepc20, HAMP
Reference	ARO-P15066
Note	For research use only.
Molecular Constructor	His Ser25–Thr84

Product name	ARO-P15066-50
Uniprot ID	P81172
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Molecular weight	9.25 kDa
Protein delivered with Tag?	N-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser25-Thr84
Aliases /Synonyms	Putative liver tumor regressor, HEPC, LEAP-1, Liver-expressed antimicrobial peptide 1, PLTR, Hepcidin, LEAP1, Hepc25, Hepc20, HAMP
Reference	ARO-P15066
Note	For research use only.
Molecular Constructor	His Ser25–Thr84

Datasheet

SDS-PAGE for Recombinant Human HAMP Protein, N-His

Recombinant Human HAMP Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human HAMP Protein, N-His”