Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TUBGCP3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96CW5
Molecular weight:
37.87 kDa

Original price was: €305.00.Current price is: €275.00.

100ug 10% OFF + 275 loyalty points
Ile245–Ser554
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TUBGCP3 Protein, N-His

Product name ARO-P12260-100
Uniprot ID Q96CW5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYS
Molecular weight 37.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile245-Ser554
Aliases /Synonyms Gamma-ring complex protein 104 kDa, GCP-3, hGrip104, Spindle pole body protein Spc98 homolog, GCP3, h104p, Gamma-tubulin complex component 3, hGCP3, TUBGCP3, hSpc98
Reference ARO-P12260
Note For research use only.
Molecular Constructor
Ile245–Ser554
Product name ARO-P12260-1MG
Uniprot ID Q96CW5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYS
Molecular weight 37.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile245-Ser554
Aliases /Synonyms Gamma-ring complex protein 104 kDa, GCP-3, hGrip104, Spindle pole body protein Spc98 homolog, GCP3, h104p, Gamma-tubulin complex component 3, hGCP3, TUBGCP3, hSpc98
Reference ARO-P12260
Note For research use only.
Molecular Constructor
Ile245–Ser554
Product name ARO-P12260-50
Uniprot ID Q96CW5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYS
Molecular weight 37.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile245-Ser554
Aliases /Synonyms Gamma-ring complex protein 104 kDa, GCP-3, hGrip104, Spindle pole body protein Spc98 homolog, GCP3, h104p, Gamma-tubulin complex component 3, hGCP3, TUBGCP3, hSpc98
Reference ARO-P12260
Note For research use only.
Molecular Constructor
Ile245–Ser554

Recombinant Human TUBGCP3 Protein: Structure, Activity, and Application

Recombinant Human TUBGCP3 protein is a highly conserved protein that plays a crucial role in the formation and function of the microtubule organizing center (MTOC). This protein is encoded by the TUBGCP3 gene and is also known as gamma-tubulin complex protein 3. Recombinant Human TUBGCP3 protein is produced through genetic engineering techniques, making it a valuable tool for studying its structure, activity, and potential applications.

Structure of Recombinant Human TUBGCP3 Protein

The primary structure of Recombinant Human TUBGCP3 protein consists of 449 amino acids, with a molecular weight of approximately 50 kDa. It contains a highly conserved C-terminal domain, which is essential for its function in the MTOC. Recombinant Human TUBGCP3 protein also has several phosphorylation sites that regulate its activity and interaction with other proteins.

In terms of secondary structure, Recombinant Human TUBGCP3 protein is composed of alpha-helices and beta-sheets, which are arranged in a globular shape. This structure is critical for its stability and function as it allows the protein to interact with other proteins and form the gamma-tubulin ring complex, which is essential for microtubule nucleation.

Activity of Recombinant Human TUBGCP3 Protein

The primary function of Recombinant Human TUBGCP3 protein is to act as a scaffold protein in the gamma-tubulin ring complex, which is responsible for the nucleation of microtubules. This complex is crucial for the organization and stability of the microtubule network, which plays a vital role in various cellular processes such as cell division, intracellular transport, and cell motility.

Recombinant Human TUBGCP3 protein is also involved in the regulation of centrosome duplication and maturation, which are essential processes for maintaining genomic stability. It interacts with other proteins in the MTOC, such as pericentrin and NEDD1, to ensure proper centrosome function.

Moreover, Recombinant Human TUBGCP3 protein has been found to play a role in cilia formation and function. Cilia are microtubule-based structures that are involved in various cellular processes, including sensing and signaling. Recombinant Human TUBGCP3 protein is essential for the proper assembly and function of cilia, making it a potential target for therapeutic interventions in ciliopathies.

Application of Recombinant Human TUBGCP3 Protein

Recombinant Human TUBGCP3 protein has various applications in both research and clinical settings. Due to its crucial role in microtubule nucleation, this protein is widely used as a marker for the MTOC in immunofluorescence studies. It can also be used as an antigen for the production of specific antibodies for studying its function and interaction with other proteins.

Furthermore, Recombinant Human TUBGCP3 protein has potential therapeutic applications. As mentioned earlier, it is involved in cilia formation and function, making it a potential target for treating ciliopathies. Additionally, abnormalities in the TUBGCP3 gene have been linked to various cancers, making it a potential target for cancer therapy.

In conclusion, Recombinant Human TUBGCP3 protein is a highly conserved protein that plays a crucial role in the organization and function of the MTOC. Its structure and activity have been extensively studied, and it has various potential

Recombinant Human TUBGCP3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TUBGCP3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products