Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SKIV2L Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15477
Molecular weight:
21.46 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Gly803–His975
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SKIV2L Protein, N-His

Product name ARO-P12263-100
Uniprot ID Q15477
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAH
Molecular weight 21.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly803-His975
Aliases /Synonyms SKIV2L, Helicase SKI2W, W, Helicase-like protein, HLP, SKI2W, Ski2, SKIV2, DDX13
Reference ARO-P12263
Note For research use only.
Molecular Constructor
Gly803–His975
Product name ARO-P12263-1MG
Uniprot ID Q15477
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAH
Molecular weight 21.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly803-His975
Aliases /Synonyms SKIV2L, Helicase SKI2W, W, Helicase-like protein, HLP, SKI2W, Ski2, SKIV2, DDX13
Reference ARO-P12263
Note For research use only.
Molecular Constructor
Gly803–His975
Product name ARO-P12263-50
Uniprot ID Q15477
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAH
Molecular weight 21.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly803-His975
Aliases /Synonyms SKIV2L, Helicase SKI2W, W, Helicase-like protein, HLP, SKI2W, Ski2, SKIV2, DDX13
Reference ARO-P12263
Note For research use only.
Molecular Constructor
Gly803–His975

Introduction

Recombinant Human SKIV2L Protein is a highly specialized protein that plays a crucial role in various cellular processes. It is a member of the superfamily of Ski2-like RNA helicases and is involved in RNA metabolism, DNA repair, and gene expression regulation. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Human SKIV2L Protein

The Recombinant Human SKIV2L Protein is a 120 kDa protein composed of 1054 amino acids. It has a conserved N-terminal Ski2 domain, a central RNA helicase domain, and a C-terminal RNA-binding domain. The Ski2 domain is responsible for protein-protein interactions, while the RNA helicase domain is involved in ATP-dependent RNA unwinding. The RNA-binding domain binds to single-stranded RNA and is essential for the protein’s RNA processing activity.

The protein also has several functional domains, including a nuclear localization signal, a nuclear export signal, and a ubiquitin-binding domain. These domains play a crucial role in the protein’s subcellular localization and function.

Activity of Recombinant Human SKIV2L Protein

The primary function of Recombinant Human SKIV2L Protein is to regulate RNA metabolism. It is involved in the processing and degradation of various types of RNA, including messenger RNA (mRNA), ribosomal RNA (rRNA), and transfer RNA (tRNA). The protein acts as an RNA helicase, using ATP hydrolysis to unwind RNA secondary structures and facilitate RNA processing.

In addition to its role in RNA metabolism, Recombinant Human SKIV2L Protein also plays a crucial role in DNA repair. It is involved in the repair of DNA double-strand breaks and is essential for maintaining genome stability. The protein interacts with other DNA repair proteins and facilitates the repair process.

Moreover, Recombinant Human SKIV2L Protein is also involved in gene expression regulation. It interacts with transcription factors and chromatin-modifying enzymes to regulate the expression of various genes. The protein’s activity in gene expression regulation is essential for normal cellular function and development.

Applications of Recombinant Human SKIV2L Protein

The unique structure and activity of Recombinant Human SKIV2L Protein make it a valuable tool in various scientific applications. The protein’s RNA helicase activity and its involvement in RNA metabolism make it an essential component in RNA processing assays. It can be used to study the mechanisms of RNA processing and degradation in vitro and in vivo.

Furthermore, Recombinant Human SKIV2L Protein’s role in DNA repair makes it a valuable tool for studying DNA repair mechanisms. It can be used in DNA repair assays to understand the protein’s role in the repair process and its interactions with other DNA repair proteins.

In addition to its use in basic research, Recombinant Human SKIV2L Protein also has potential clinical applications. Mutations in the gene that encodes this protein have been linked to various diseases, including cancer and neurodegenerative disorders. Therefore, the protein can be used as a diagnostic marker for these diseases and as a potential therapeutic target.

Conclusion

Recombinant Human SKIV2L Protein is a highly specialized protein with a unique structure and activity. Its involvement in various cellular processes, including RNA metabolism, DNA repair, and gene expression regulation, makes it an essential component in many scientific applications. The protein’s potential clinical applications further highlight its importance in both basic research and medical research. With further studies, Recombinant Human SKIV2L Protein may hold promise as a potential target for the treatment of various diseases.

Recombinant Human SKIV2L Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SKIV2L Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products